Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03816
Gene name
Locationscaffold_04:17540..18865
Strand+
Gene length (bp)1325
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 1.9E-20 53 159
PF13242 Hydrolase_like HAD-hyrolase-like 2.0E-15 298 389

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1573 0.1396 0.0708 0.0626 0.8877 0.0695 0.0493 0.0466 0.0462 0.0838

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2904
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6476
Ophiocordyceps australis map64 (Brazil) OphauB2|857
Ophiocordyceps camponoti-floridani Ophcf2|03816 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1162
Ophiocordyceps kimflemingae Ophio5|3607
Ophiocordyceps subramaniannii Hirsu2|4845

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03816
MTLARSPSNLSLGQATKVLKCFTDSGNRRQFSKSARRNRQSPSSSSGPESFAFAFDIDGVLCHGNQPLPAAREAI
RTIRAIGSPYVFLTNGGGVSEDDKAASLAQRLGYHPDDDVIRRRLILSHSPFRDWSENAKNRRVLITASNPETAR
AVANEYGFTDAVTPADIIQNVENFYPFDRLMNITPHPHRRFSPEESRFHSILVWNDPRDWSLDIQIIHDLLVSRQ
GHLGTISNKNGDVSLPNKGWQQDGQPSLWISNLDLFWKTEYPVNRFGTGAFVEALKGVWSAVTDGAELKFQALGK
PFGSAYGFAHKRILNHYHGTEGLDTNKLRRVYMIGDNPESDIRGANEFRPEDGTEWVPILVRTGVWKKTTAEPEP
RHRPAVIVDDVLEAVVWAINKEGRTLPVNLTA*
Coding >Ophcf2|03816
ATGACATTGGCTCGCTCCCCGTCGAATCTTTCTCTCGGACAAGCCACGAAAGTCCTGAAATGTTTCACAGATTCG
GGGAACAGGCGGCAATTTAGTAAGTCGGCGCGCCGCAACCGGCAGTCCCCGTCTAGTTCCTCGGGACCGGAATCT
TTCGCCTTTGCCTTCGACATCGATGGTGTCTTGTGTCACGGCAATCAGCCGCTCCCTGCGGCCCGCGAGGCAATC
CGAACCATCCGCGCAATTGGCAGTCCCTACGTCTTCCTGACCAACGGTGGTGGCGTTAGTGAGGACGATAAAGCT
GCTTCCCTGGCTCAGCGACTCGGCTATCATCCGGATGATGATGTGATCCGGAGAAGGCTCATTCTTTCACACTCG
CCTTTTCGCGACTGGAGTGAGAATGCCAAGAACCGAAGGGTCTTGATCACGGCTTCAAATCCAGAGACGGCACGC
GCAGTGGCAAACGAGTACGGATTCACGGACGCTGTGACACCAGCGGATATCATCCAAAACGTCGAGAATTTCTAT
CCCTTTGATCGCCTCATGAACATAACTCCCCATCCGCATCGCCGCTTTTCGCCCGAAGAATCCAGATTTCACTCG
ATTTTGGTATGGAACGACCCAAGAGACTGGTCTCTCGATATTCAAATAATTCACGACCTCTTAGTGTCTCGTCAA
GGGCACCTCGGCACCATCTCCAACAAAAACGGAGACGTTTCCCTACCCAATAAGGGATGGCAGCAGGACGGCCAG
CCCAGTCTTTGGATTTCGAACCTCGATCTCTTCTGGAAGACGGAATACCCAGTCAACCGATTCGGCACGGGCGCA
TTTGTCGAGGCCCTAAAAGGGGTCTGGTCAGCCGTCACTGATGGCGCTGAGCTCAAGTTCCAGGCCCTCGGAAAG
CCCTTCGGATCTGCTTATGGCTTTGCTCACAAGCGAATCCTCAACCACTATCATGGAACCGAGGGACTCGACACC
AATAAATTACGAAGGGTGTATATGATCGGCGACAACCCGGAAAGTGACATCCGAGGGGCCAACGAGTTTCGACCC
GAAGACGGGACGGAATGGGTCCCAATTCTCGTCAGAACGGGCGTCTGGAAGAAGACGACGGCTGAGCCAGAGCCG
CGCCATCGGCCGGCTGTCATTGTTGACGATGTCTTGGAGGCTGTGGTCTGGGCCATTAACAAAGAGGGGCGGACT
TTGCCGGTGAATCTTACGGCTTAG
Transcript >Ophcf2|03816
ATGACATTGGCTCGCTCCCCGTCGAATCTTTCTCTCGGACAAGCCACGAAAGTCCTGAAATGTTTCACAGATTCG
GGGAACAGGCGGCAATTTAGTAAGTCGGCGCGCCGCAACCGGCAGTCCCCGTCTAGTTCCTCGGGACCGGAATCT
TTCGCCTTTGCCTTCGACATCGATGGTGTCTTGTGTCACGGCAATCAGCCGCTCCCTGCGGCCCGCGAGGCAATC
CGAACCATCCGCGCAATTGGCAGTCCCTACGTCTTCCTGACCAACGGTGGTGGCGTTAGTGAGGACGATAAAGCT
GCTTCCCTGGCTCAGCGACTCGGCTATCATCCGGATGATGATGTGATCCGGAGAAGGCTCATTCTTTCACACTCG
CCTTTTCGCGACTGGAGTGAGAATGCCAAGAACCGAAGGGTCTTGATCACGGCTTCAAATCCAGAGACGGCACGC
GCAGTGGCAAACGAGTACGGATTCACGGACGCTGTGACACCAGCGGATATCATCCAAAACGTCGAGAATTTCTAT
CCCTTTGATCGCCTCATGAACATAACTCCCCATCCGCATCGCCGCTTTTCGCCCGAAGAATCCAGATTTCACTCG
ATTTTGGTATGGAACGACCCAAGAGACTGGTCTCTCGATATTCAAATAATTCACGACCTCTTAGTGTCTCGTCAA
GGGCACCTCGGCACCATCTCCAACAAAAACGGAGACGTTTCCCTACCCAATAAGGGATGGCAGCAGGACGGCCAG
CCCAGTCTTTGGATTTCGAACCTCGATCTCTTCTGGAAGACGGAATACCCAGTCAACCGATTCGGCACGGGCGCA
TTTGTCGAGGCCCTAAAAGGGGTCTGGTCAGCCGTCACTGATGGCGCTGAGCTCAAGTTCCAGGCCCTCGGAAAG
CCCTTCGGATCTGCTTATGGCTTTGCTCACAAGCGAATCCTCAACCACTATCATGGAACCGAGGGACTCGACACC
AATAAATTACGAAGGGTGTATATGATCGGCGACAACCCGGAAAGTGACATCCGAGGGGCCAACGAGTTTCGACCC
GAAGACGGGACGGAATGGGTCCCAATTCTCGTCAGAACGGGCGTCTGGAAGAAGACGACGGCTGAGCCAGAGCCG
CGCCATCGGCCGGCTGTCATTGTTGACGATGTCTTGGAGGCTGTGGTCTGGGCCATTAACAAAGAGGGGCGGACT
TTGCCGGTGAATCTTACGGCTTAG
Gene >Ophcf2|03816
ATGACATTGGCTCGCTCCCCGTCGAATCTTTCTCTCGGACAAGCCACGAAAGTCCTGAAATGTTTCACAGATTCG
GGGAACAGGCGGCAATTTAGTAAGTCGGCGCGCCGCAACCGGCAGTCCCCGTCTAGTTCCTCGGGACCGGAATCT
TTCGCCTTTGCCTTCGAGTACGACATTCTCCCGCCTCGTCGAGACAACCAGCTGACGGGTGCGCGGCAGCATCGA
TGGTGTCTTGTGTCACGGCAATCAGCCGCTCCCTGCGGCCCGCGAGGCAATCCGAACCATCCGCGCAATTGGCAG
TCCCTACGTCTTCCTGACCAACGGTGGTGGCGTTAGTGAGGACGATAAAGCTGCTTCCCTGGCTCAGCGACTCGG
CTATCATCCGGATGATGATGTGATCCGGAGAAGGCTCATTCTTTCACACTCGCCTTTTCGCGACTGGAGTGAGAA
TGCCAAGAACCGAAGGGTCTTGATCACGGCTTCAAATCCAGAGACGGCACGCGCAGTGGCAAACGAGTGAGTGGC
CTGCCGGGTTTATAGATGTACACCAGCCAATGGCAACCAGGTACGGATTCACGGACGCTGTGACACCAGCGGATA
TCATCCAAAACGTCGAGAATTTCTATCCCTTTGATCGCCTCATGAACATAACTCCCCATCCGCATCGCCGCTTTT
CGCCCGAAGAATCCAGATTTCACTCGATTTTGGTATGGAACGACCCAAGAGACTGGTCTCTCGATATTCAAATAA
TTCACGACCTCTTAGTGTCTCGTCAAGGGCACCTCGGCACCATCTCCAACAAAAACGGAGACGTTTCCCTACCCA
ATAAGGGATGGCAGCAGGACGGCCAGCCCAGTCTTTGGATTTCGAACCTCGATCTCTTCTGGAAGACGGAATACC
CAGTCAACCGATTCGGCACGGGCGCATTTGTCGAGGCCCTAAAAGGGGTCTGGTCAGCCGTCACTGATGGCGCTG
AGCTCAAGTTCCAGGCCCTCGGAAAGCCCTTCGGATCTGCTTATGGCTTTGCTCACAAGCGAATCCTCAACCACT
ATCATGGAACCGAGGGACTCGACACCAATAAATTACGAAGGGTGTATATGATCGGCGACAACCCGGAAAGTGACA
TCCGAGGGGCCAACGAGTTTCGACCCGAAGACGGGACGGAATGGGTCCCAATTCTCGTCAGAACGGGCGTCTGGA
AGAAGACGACGGCTGAGCCAGAGCCGCGCCATCGGCCGGCTGTCATTGTTGACGATGTCTTGGAGGCTGTGGTCT
GGGCCATTAACAAAGAGGGGCGGACTTTGCCGGTGAATCTTACGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail