Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03813
Gene name
Locationscaffold_04:12655..14891
Strand+
Gene length (bp)2236
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Plastid 0.3691 0.3133 0.3182 0.1212 0.4341 0.4502 0.2582 0.1995 0.352 0.3096

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1351
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03813 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5825
Ophiocordyceps subramaniannii Hirsu2|10756
Ophiocordyceps subramaniannii Hirsu2|2981
Ophiocordyceps subramaniannii Hirsu2|3370
Ophiocordyceps subramaniannii Hirsu2|3900
Ophiocordyceps subramaniannii Hirsu2|862

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03813
MCMRELLGQDNETSKRETILTQKASSTQKASTTGRSQGQESNHRYPETKGSVGYEVCGDFVLCYIRSKCHERASE
ALESIRERVKRLSSELTLAEVEAQVKEAICSPAKQAKQGTAAQASDCASPDGCPISSPVESARPALPNLIEACDE
AISSEFSWFAAEPTSKEVFDWLNAQDNAEDNLCSAPGVLDVVVLDLTAERGNDTAAAECRTRVSQLLEPVRSKPS
GSRGSSTAEVISDVTHALCSELLTQGMQGQTPSTSGAAGRSRPCEASVSNSLSHRLEARPLEAVFEWLESRGTAE
ADLCPEFVFPFPDSGDDQETTERCRRRVSGALQSVRTRVSQSDGQANVGLEVAQSVCLPSTSSSEQSQDQSTRPK
QRKTAQPLNASHALQACQASISASLENRTQQSLLEWLEDPGRPELDLCSQLPVLDIDALDLDEGDASGAEPSLGR
TPGWDFLIHALEDSFGINEEELEQAVDNPPPLQGPLPRVHQQLEDISPSINGILADMFNRGIALALCASTRSGKI
PSSRRTVRAALDKKLDVRAKVLLCHRLMNALIEGLSLNASVPMELTNRTATTALASSTVIPEFSKELQKLEDLQR
NRHEIGILLGPLGGLFAGTGAVLAASSPAVTSLLSSLASKLNLPFGARAGTGAVGWSSRATLSTINQFMARFVSQ
*
Coding >Ophcf2|03813
ATGTGCATGCGCGAACTCCTTGGTCAAGATAATGAAACATCTAAGCGAGAGACAATACTTACGCAAAAGGCATCA
TCCACGCAAAAGGCGAGCACTACCGGCCGCAGCCAGGGCCAAGAATCCAATCATAGATATCCCGAGACCAAGGGT
TCTGTTGGATACGAAGTGTGCGGCGACTTCGTCTTGTGTTATATCAGAAGCAAGTGCCACGAACGCGCCTCTGAA
GCCCTGGAGTCGATTCGTGAACGGGTGAAGAGGCTATCGTCAGAGCTGACGCTGGCAGAAGTCGAGGCTCAGGTC
AAAGAGGCGATTTGCTCGCCCGCAAAGCAAGCCAAGCAGGGTACTGCCGCCCAAGCCTCTGACTGCGCGTCGCCC
GACGGATGTCCGATAAGTAGTCCCGTCGAAAGCGCCAGACCCGCGTTGCCCAATCTCATCGAGGCCTGTGATGAG
GCCATATCGTCCGAGTTCAGTTGGTTTGCCGCGGAACCGACGTCCAAAGAAGTTTTTGACTGGTTAAACGCCCAA
GACAACGCCGAGGACAACCTATGCTCGGCGCCTGGCGTGCTGGACGTTGTGGTGCTCGACCTAACGGCTGAAAGG
GGAAATGACACAGCGGCTGCCGAATGCCGCACCCGCGTCTCCCAGTTGTTGGAGCCGGTCCGAAGCAAGCCCAGC
GGCAGTCGGGGTTCCTCGACAGCCGAAGTTATCAGCGACGTGACGCACGCCCTCTGCTCGGAACTATTGACGCAG
GGGATGCAGGGCCAGACCCCTTCCACTTCGGGGGCAGCCGGGAGAAGCAGGCCCTGCGAAGCATCAGTGTCTAAC
TCTTTATCGCACAGACTCGAGGCCAGGCCTTTGGAAGCCGTGTTTGAATGGCTGGAGAGCAGGGGCACGGCCGAA
GCCGACCTATGTCCTGAGTTCGTATTCCCCTTCCCAGACTCGGGTGACGATCAAGAGACCACCGAGCGTTGCAGG
AGACGCGTGTCAGGAGCATTGCAATCTGTGCGAACAAGGGTGTCTCAAAGTGACGGCCAGGCCAATGTCGGGTTA
GAAGTGGCACAATCTGTCTGCTTGCCGTCGACGTCTTCGTCCGAGCAGTCGCAGGACCAGTCGACACGGCCGAAA
CAGCGAAAGACGGCGCAGCCGCTTAACGCATCCCACGCCTTGCAAGCCTGCCAAGCATCTATATCGGCTTCGCTC
GAGAACCGGACGCAGCAGAGTCTGTTGGAGTGGTTGGAGGATCCTGGCAGGCCCGAACTTGACCTTTGTTCTCAA
TTACCCGTGTTGGACATAGACGCCCTGGATCTGGACGAAGGAGATGCGAGCGGTGCAGAGCCGTCTCTGGGTCGA
ACGCCCGGCTGGGATTTTCTTATCCACGCCTTGGAGGATTCGTTCGGCATCAATGAGGAGGAGCTGGAACAAGCA
GTAGACAACCCACCTCCATTGCAGGGCCCGCTTCCCAGGGTACATCAACAACTGGAGGACATTTCCCCTTCCATA
AATGGCATCTTGGCCGACATGTTCAACCGTGGCATCGCTCTCGCATTATGCGCGTCGACCAGAAGTGGGAAAATT
CCCTCCTCACGGCGGACCGTCCGCGCCGCGCTAGATAAGAAGCTGGATGTGAGGGCAAAGGTGTTGCTATGCCAT
CGGCTCATGAATGCTTTGATCGAGGGCCTCAGTTTGAACGCAAGTGTCCCGATGGAGTTGACGAACAGAACAGCC
ACGACGGCGCTCGCGTCCTCAACGGTCATCCCCGAGTTTTCCAAGGAGCTTCAGAAGCTAGAAGATTTGCAAAGA
AACCGACATGAAATAGGCATCTTACTGGGTCCCCTGGGCGGCTTATTTGCCGGGACCGGCGCAGTTCTCGCGGCG
TCATCGCCAGCGGTGACGAGCCTCCTCTCCTCGCTAGCATCGAAACTCAATCTTCCTTTCGGCGCGAGGGCCGGC
ACGGGAGCTGTCGGTTGGAGCTCTCGGGCTACTCTTTCGACTATCAACCAGTTCATGGCCAGGTTTGTGTCGCAG
TAG
Transcript >Ophcf2|03813
ATGTGCATGCGCGAACTCCTTGGTCAAGATAATGAAACATCTAAGCGAGAGACAATACTTACGCAAAAGGCATCA
TCCACGCAAAAGGCGAGCACTACCGGCCGCAGCCAGGGCCAAGAATCCAATCATAGATATCCCGAGACCAAGGGT
TCTGTTGGATACGAAGTGTGCGGCGACTTCGTCTTGTGTTATATCAGAAGCAAGTGCCACGAACGCGCCTCTGAA
GCCCTGGAGTCGATTCGTGAACGGGTGAAGAGGCTATCGTCAGAGCTGACGCTGGCAGAAGTCGAGGCTCAGGTC
AAAGAGGCGATTTGCTCGCCCGCAAAGCAAGCCAAGCAGGGTACTGCCGCCCAAGCCTCTGACTGCGCGTCGCCC
GACGGATGTCCGATAAGTAGTCCCGTCGAAAGCGCCAGACCCGCGTTGCCCAATCTCATCGAGGCCTGTGATGAG
GCCATATCGTCCGAGTTCAGTTGGTTTGCCGCGGAACCGACGTCCAAAGAAGTTTTTGACTGGTTAAACGCCCAA
GACAACGCCGAGGACAACCTATGCTCGGCGCCTGGCGTGCTGGACGTTGTGGTGCTCGACCTAACGGCTGAAAGG
GGAAATGACACAGCGGCTGCCGAATGCCGCACCCGCGTCTCCCAGTTGTTGGAGCCGGTCCGAAGCAAGCCCAGC
GGCAGTCGGGGTTCCTCGACAGCCGAAGTTATCAGCGACGTGACGCACGCCCTCTGCTCGGAACTATTGACGCAG
GGGATGCAGGGCCAGACCCCTTCCACTTCGGGGGCAGCCGGGAGAAGCAGGCCCTGCGAAGCATCAGTGTCTAAC
TCTTTATCGCACAGACTCGAGGCCAGGCCTTTGGAAGCCGTGTTTGAATGGCTGGAGAGCAGGGGCACGGCCGAA
GCCGACCTATGTCCTGAGTTCGTATTCCCCTTCCCAGACTCGGGTGACGATCAAGAGACCACCGAGCGTTGCAGG
AGACGCGTGTCAGGAGCATTGCAATCTGTGCGAACAAGGGTGTCTCAAAGTGACGGCCAGGCCAATGTCGGGTTA
GAAGTGGCACAATCTGTCTGCTTGCCGTCGACGTCTTCGTCCGAGCAGTCGCAGGACCAGTCGACACGGCCGAAA
CAGCGAAAGACGGCGCAGCCGCTTAACGCATCCCACGCCTTGCAAGCCTGCCAAGCATCTATATCGGCTTCGCTC
GAGAACCGGACGCAGCAGAGTCTGTTGGAGTGGTTGGAGGATCCTGGCAGGCCCGAACTTGACCTTTGTTCTCAA
TTACCCGTGTTGGACATAGACGCCCTGGATCTGGACGAAGGAGATGCGAGCGGTGCAGAGCCGTCTCTGGGTCGA
ACGCCCGGCTGGGATTTTCTTATCCACGCCTTGGAGGATTCGTTCGGCATCAATGAGGAGGAGCTGGAACAAGCA
GTAGACAACCCACCTCCATTGCAGGGCCCGCTTCCCAGGGTACATCAACAACTGGAGGACATTTCCCCTTCCATA
AATGGCATCTTGGCCGACATGTTCAACCGTGGCATCGCTCTCGCATTATGCGCGTCGACCAGAAGTGGGAAAATT
CCCTCCTCACGGCGGACCGTCCGCGCCGCGCTAGATAAGAAGCTGGATGTGAGGGCAAAGGTGTTGCTATGCCAT
CGGCTCATGAATGCTTTGATCGAGGGCCTCAGTTTGAACGCAAGTGTCCCGATGGAGTTGACGAACAGAACAGCC
ACGACGGCGCTCGCGTCCTCAACGGTCATCCCCGAGTTTTCCAAGGAGCTTCAGAAGCTAGAAGATTTGCAAAGA
AACCGACATGAAATAGGCATCTTACTGGGTCCCCTGGGCGGCTTATTTGCCGGGACCGGCGCAGTTCTCGCGGCG
TCATCGCCAGCGGTGACGAGCCTCCTCTCCTCGCTAGCATCGAAACTCAATCTTCCTTTCGGCGCGAGGGCCGGC
ACGGGAGCTGTCGGTTGGAGCTCTCGGGCTACTCTTTCGACTATCAACCAGTTCATGGCCAGGTTTGTGTCGCAG
TAG
Gene >Ophcf2|03813
ATGTGCATGCGCGAACTCCTTGGTCAAGATAATGAAACATCTAAGCGAGAGACAATACTTACGCAAAAGGCATCA
TCCACGCAAAAGGCGAGCACTACCGGCCGCAGCCAGGGCCAAGAATCCAATCATAGATATCGTACGTATATACTT
GATGTGTTTCGAATCCCCGCAACATCCTGGACTTACTCGTCTCATTTAGCCGAGACCAAGGGTTCTGTTGGATAC
GAAGTGTGCGGCGACTTCGTCTTGTGTTATATCAGAAGCAAGTGCCACGAACGCGCCTCTGAAGCCCTGGAGTCG
ATTCGTGAACGGGTGAAGAGGCTATCGTCAGAGCTGACGCTGGCAGAAGTCGAGGCTCAGGTCAAAGAGGCGATT
TGCTCGCCCGCAAAGCAAGCCAAGCAGGGTACTGCCGCCCAAGCCTCTGACTGCGCGTCGCCCGACGGATGTCCG
ATAAGTAGTCCCGTCGAAAGCGCCAGACCCGCGTTGCCCAATCTCATCGAGGCCTGTGATGAGGCCATATCGTCC
GAGTTCAGTTGGTTTGCCGCGGAACCGACGTCCAAAGAAGTTTTTGACTGGTTAAACGCCCAAGACAACGCCGAG
GACAACCTATGCTCGGCGCCTGGCGTGCTGGACGTTGTGGTGCTCGACCTAACGGCTGAAAGGGGAAATGACACA
GCGGCTGCCGAATGCCGCACCCGCGTCTCCCAGTTGTTGGAGCCGGTCCGAAGCAAGCCCAGCGGCAGTCGGGGT
TCCTCGACAGCCGAAGTTATCAGCGACGTGACGCACGCCCTCTGCTCGGAACTATTGACGCAGGGGATGCAGGGC
CAGACCCCTTCCACTTCGGGGGCAGCCGGGAGAAGCAGGCCCTGCGAAGCATCAGTGTCTAACTCTTTATCGCAC
AGACTCGAGGCCAGGCCTTTGGAAGCCGTGTTTGAATGGCTGGAGAGCAGGGGCACGGCCGAAGCCGACCTATGT
CCTGAGTTCGTATTCCCCTTCCCAGACTCGGGTGACGATCAAGAGACCACCGAGCGTTGCAGGAGACGCGTGTCA
GGAGCATTGCAATCTGTGCGAACAAGGGTGTCTCAAAGTGACGGCCAGGCCAATGTCGGGTTAGAAGTGGCACAA
TCTGTCTGCTTGCCGTCGACGTCTTCGTCCGAGCAGTCGCAGGACCAGTCGACACGGCCGAAACAGCGAAAGACG
GCGCAGCCGCTTAACGCATCCCACGCCTTGCAAGCCTGCCAAGCATCTATATCGGCTTCGCTCGAGAACCGGACG
CAGCAGAGTCTGTTGGAGTGGTTGGAGGATCCTGGCAGGCCCGAACTTGACCTTTGTTCTCAATTACCCGTGTTG
GACATAGACGCCCTGGATCTGGACGAAGGAGATGCGAGCGGTGCAGAGCCGTCTCTGGGTCGAACGCCCGGCTGG
GATTTTCTTATCCACGCCTTGGAGGATTCGTTCGGCATCAATGAGGAGGAGCTGGAACAAGCAGTAGACAACCCA
CCTCCATTGCAGGGCCCGCTTCCCAGGGTACATCAACAACTGGAGGACATTTCCCCTTCCATAAATGGCATCTTG
GCCGACATGTTCAACCGTGGCATCGCTCTCGCATTATGCGCGTCGACCAGAAGTGGGAAAATTCCCTCCTCACGG
CGGACCGTCCGCGCCGCGCTAGATAAGAAGCTGGATGTGAGGGCAAAGGTGTTGCTATGCCATCGGCTCATGAAT
GCTTTGATCGAGGGCCTCAGTTTGAACGCAAGTGTCCCGATGGAGTTGACGAACAGAACAGCCACGACGGCGCTC
GCGTCCTCAACGGTCATCCCCGAGTTTTCCAAGGAGCTTCAGAAGCTAGAAGATTTGCAAAGAAACCGACATGAA
ATAGGCATCTTACTGGGTCCCCTGGGCGGCTTATTTGCCGGGACCGGCGCAGTTCTCGCGGCGTCATCGCCAGCG
GTGACGAGCCTCCTCTCCTCGCTAGCATCGAAACTCAATCTTCCTTTCGGCGCGAGGGCCGGCACGGGAGCTGTC
GGTTGGAGCTCTCGGGCTACTCTTTCGACTATCAACCAGTTCATGGCCAGGTTTGTGTCGCAGGTACGCAGGCTG
TTGTCGCAGGCGCTCGGCCGGAGTCTGATTCGTCGCGTTCCGCGACATACATTGACAAGGCTTGTTGGGAAATGG
GTTGTCGAGGCTTTGAACCGCGGTTTCCAGATTGCCACTGAGACAATACCGTTATTAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail