Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03805
Gene name
Locationscaffold_03:3883236..3884039
Strand-
Gene length (bp)803
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00810 ER_lumen_recept ER lumen protein retaining receptor 3.8E-55 30 170

GO

GO Term Description Terminal node
GO:0006621 protein retention in ER lumen Yes
GO:0046923 ER retention sequence binding Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0051235 maintenance of location No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0042277 peptide binding No
GO:0072595 maintenance of protein localization in organelle No
GO:0035437 maintenance of protein localization in endoplasmic reticulum No
GO:0033218 amide binding No
GO:0005488 binding No
GO:0051651 maintenance of location in cell No
GO:0005048 signal sequence binding No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0045185 maintenance of protein location No
GO:0032507 maintenance of protein location in cell No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 112 17
3 119 138 19
4 181 203 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03805
MVLNVFRIAADLSHLASILILLHKMVQLNSCSGISFKSQALYLFVYVTRYLDLFSTESIYNLIFKILFIGSQGYI
IYLMANAYKPTNDPNVDTFRVQYLIGGAAVLAVLFPYKYTVSEILWAFSIWLESVAILPQLFMLQRTGEAETITT
HYLFALGSYRALYIPNWIYRYFAEPTHKPDWIAIIAGIVQTILYSDFFYIYYTKVLKGQKFKLPV*
Coding >Ophcf2|03805
ATGGTGCTCAACGTCTTCCGCATTGCTGCGGATCTCTCGCATCTGGCGAGCATCCTCATCCTTCTCCATAAGATG
GTTCAGCTCAACAGCTGCTCCGGCATTTCGTTTAAGTCGCAAGCTCTCTATCTCTTCGTCTACGTCACCCGCTAC
CTCGACTTGTTCTCGACCGAAAGCATCTACAACCTCATCTTTAAGATCCTCTTCATCGGCTCCCAGGGTTACATC
ATCTACCTCATGGCCAACGCCTACAAGCCGACCAATGACCCCAATGTCGACACATTCCGCGTCCAATATCTCATT
GGAGGAGCAGCTGTCCTCGCCGTCCTCTTCCCCTACAAATACACCGTCTCCGAGATTCTCTGGGCCTTTTCCATC
TGGCTAGAGTCGGTGGCCATCCTGCCGCAGCTCTTCATGCTTCAGCGCACAGGCGAGGCTGAGACCATCACGACG
CATTATCTGTTCGCCCTCGGCAGCTATAGAGCTCTGTATATCCCCAATTGGATCTACCGCTACTTCGCAGAGCCC
ACGCACAAGCCCGACTGGATCGCCATCATCGCTGGCATCGTCCAAACTATCCTCTACAGCGACTTTTTCTACATT
TACTACACCAAGGTGTTGAAGGGACAAAAGTTCAAGCTCCCAGTATAA
Transcript >Ophcf2|03805
ATGGTGCTCAACGTCTTCCGCATTGCTGCGGATCTCTCGCATCTGGCGAGCATCCTCATCCTTCTCCATAAGATG
GTTCAGCTCAACAGCTGCTCCGGCATTTCGTTTAAGTCGCAAGCTCTCTATCTCTTCGTCTACGTCACCCGCTAC
CTCGACTTGTTCTCGACCGAAAGCATCTACAACCTCATCTTTAAGATCCTCTTCATCGGCTCCCAGGGTTACATC
ATCTACCTCATGGCCAACGCCTACAAGCCGACCAATGACCCCAATGTCGACACATTCCGCGTCCAATATCTCATT
GGAGGAGCAGCTGTCCTCGCCGTCCTCTTCCCCTACAAATACACCGTCTCCGAGATTCTCTGGGCCTTTTCCATC
TGGCTAGAGTCGGTGGCCATCCTGCCGCAGCTCTTCATGCTTCAGCGCACAGGCGAGGCTGAGACCATCACGACG
CATTATCTGTTCGCCCTCGGCAGCTATAGAGCTCTGTATATCCCCAATTGGATCTACCGCTACTTCGCAGAGCCC
ACGCACAAGCCCGACTGGATCGCCATCATCGCTGGCATCGTCCAAACTATCCTCTACAGCGACTTTTTCTACATT
TACTACACCAAGGTGTTGAAGGGACAAAAGTTCAAGCTCCCAGTATAA
Gene >Ophcf2|03805
ATGGTGCTCAACGTCTTCCGCATTGCTGGTGCGTCTCATCGCTGGCCATGCCAAGTCCGAGCTGATTCGGCCGAC
AGCGGATCTCTCGCATCTGGCGAGCATCCTCATCCTTCTCCATAAGATGGTTCAGCTCAACGTAGGCATTTCGTT
GCCCGCTGCCCTCGCGCAGAGCTGACTCCCGCCTAGAGCTGCTCCGGCATTTCGTTTAAGTCGCAAGCTCTCTAT
CTCTTCGTCTACGTCACCCGCTACCTCGGCATGTGTTTTCGTCGTCTTATTGTTGCTCTCCGTCCTCCGCTAACT
AGCCGCCAGACTTGTTCTCGACCGAAAGCATCTACAACCTCATCTTTAAGATCCTCTTCATCGGCTCCCAGGGTT
ACATCATCTACCTCATGGCCAACGCCTACAAGCCGACCAATGACCCCAATGTCGACACATTCCGCGTCCAATATC
TCATTGGAGGAGCAGCTGTCCTCGCCGTCCTCTTCCCCTACAAATACACCGTCTCCGAGATTCTCTGGGCCTTTT
CCATCTGGCTAGAGTCGGTGGCCATCCTGCCGCAGCTCTTCATGCTTCAGCGCACAGGCGAGGCTGAGACCATCA
CGACGCATTATCTGTTCGCCCTCGGCAGCTATAGAGCTCTGTATATCCCCAATTGGATCTACCGCTACTTCGCAG
AGCCCACGCACAAGCCCGACTGGATCGCCATCATCGCTGGCATCGTCCAAACTATCCTCTACAGCGACTTTTTCT
ACATTTACTACACCAAGGTGTTGAAGGGACAAAAGTTCAAGCTCCCAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail