Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03787
Gene name
Locationscaffold_03:3833633..3834403
Strand-
Gene length (bp)770
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 19 41 22
2 61 83 22
3 90 108 18
4 118 140 22
5 153 175 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 60.36 28.30 92.43
Alive In ants, during behavior modification 47.20 20.13 74.27
Dead In ants, recently dead 39.26 16.37 62.16

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.344481 no
Alive Dead 0.437253 no
Dead Fungus 0.076590 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03787
MALNGWFPPSTRARYETMLLLWQLIFPIMGSMQWFIEWYGMGKTSRPSRLNLPGRGAWMTMEAPGFLMLVYTVHS
LSGGVAGLPWRNQVLTGLFVIHYIYRAILFPLLQPSMAPIHLAVWTMALTFQLLNASCLGAWLAVHGPTTAQEWT
RQSPLPQFILGLSLFYAGLAANFFHDEEGWVL*
Coding >Ophcf2|03787
ATGGCCCTCAACGGCTGGTTTCCCCCCTCCACCCGTGCCCGCTACGAAACGATGCTACTTCTATGGCAGCTCATC
TTCCCCATCATGGGATCGATGCAATGGTTCATTGAGTGGTATGGGATGGGGAAGACTTCGAGACCTAGCAGGTTG
AATCTTCCGGGGAGGGGGGCGTGGATGACGATGGAGGCGCCTGGGTTTCTGATGCTGGTTTATACGGTTCATTCG
CTTTCGGGCGGGGTGGCGGGTCTGCCTTGGAGGAATCAGGTCCTCACCGGCCTCTTCGTCATCCACTACATCTAC
CGCGCAATCCTCTTCCCCCTCCTCCAACCCTCCATGGCCCCCATCCACCTCGCCGTCTGGACAATGGCGCTCACC
TTCCAGCTCCTAAACGCAAGCTGCCTGGGCGCCTGGCTAGCCGTGCACGGCCCAACCACAGCGCAAGAATGGACG
CGGCAAAGTCCCCTCCCGCAATTCATCCTCGGCCTAAGCCTCTTCTACGCCGGACTGGCGGCGAATTTCTTCCAC
GATGAGGAGGGGTGGGTATTATGA
Transcript >Ophcf2|03787
ATGGCCCTCAACGGCTGGTTTCCCCCCTCCACCCGTGCCCGCTACGAAACGATGCTACTTCTATGGCAGCTCATC
TTCCCCATCATGGGATCGATGCAATGGTTCATTGAGTGGTATGGGATGGGGAAGACTTCGAGACCTAGCAGGTTG
AATCTTCCGGGGAGGGGGGCGTGGATGACGATGGAGGCGCCTGGGTTTCTGATGCTGGTTTATACGGTTCATTCG
CTTTCGGGCGGGGTGGCGGGTCTGCCTTGGAGGAATCAGGTCCTCACCGGCCTCTTCGTCATCCACTACATCTAC
CGCGCAATCCTCTTCCCCCTCCTCCAACCCTCCATGGCCCCCATCCACCTCGCCGTCTGGACAATGGCGCTCACC
TTCCAGCTCCTAAACGCAAGCTGCCTGGGCGCCTGGCTAGCCGTGCACGGCCCAACCACAGCGCAAGAATGGACG
CGGCAAAGTCCCCTCCCGCAATTCATCCTCGGCCTAAGCCTCTTCTACGCCGGACTGGCGGCGAATTTCTTCCAC
GATGAGGAGGGGTGGGTATTATGA
Gene >Ophcf2|03787
ATGGCCCTCAACGGCTGGTTTCCCCCCTCCACCCGTGCCCGCTACGAAACGATGCTACTTCTATGGCAGCTCATC
TTCCCCATCGCAAGTTCCCCCCCCCCCCTTGGGAGTATGTCGACGGCGAATCGCTGATGAGGAGATGGGGGCAGA
TGGGATCGATGCAATGGTTCATTGAGTGGTATGGGATGGGGAAGACTTCGAGACCTAGCAGGTTGAATCTTCCGG
GGAGGGGGGCGTGGATGACGATGGAGGCGCCTGGGTTTCTGATGCTGGTTTATACGGTTCATTCGCTTTCGGGCG
GGGTGGCGGGTCTGCCTTGGAGGAATCAGGTCCTCACCGGCCTCTTCGTACCCCCCTCCCCCCCCCCCCAAAATT
GATTCTATACAGACAGATGGAAGCTGACTATCTATGTATGTAGGTCATCCACTACATCTACCGCGCAATCCTCTT
CCCCCTCCTCCAACCCTCCATGGCCCCCATCCACCTCGCCGTCTGGACAATGGCGCTCACCTTCCAGCTCCTAAA
CGCAAGCTGCCTGGGCGCCTGGCTAGCCGTGCACGGCCCAACCACAGCGCAAGAATGGACGCGGCAAAGTCCCCT
CCCGCAATTCATCCTCGGCCTAAGCCTCTTCTACGCCGGACTGGCGGCGAATTTCTTCCACGATGAGGAGTTGAG
GGAGATTCGAAGGCGGCGGCTTCGTCGTCTTCGTCACGAGCATCGTCGTGGTGGTGACCAGAGGGGTGGGGGTTA
CAAGGGGGTGGGTATTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail