Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03786
Gene name
Locationscaffold_03:3832322..3833023
Strand+
Gene length (bp)701
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 8.7E-18 18 103
PF16211 Histone_H2A_C C-terminus of histone H2A 1.4E-12 105 137
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 6.4E-05 37 101

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3558 0.6131 0.0209 0.1223 0.0963 0.0171 0.0658 0.1094 0.014 0.008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7961
Ophiocordyceps australis map64 (Brazil) OphauB2|2924
Ophiocordyceps camponoti-floridani Ophcf2|03786 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7155
Ophiocordyceps kimflemingae Ophio5|5002
Ophiocordyceps subramaniannii Hirsu2|6330

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03786
MPGGKGKSAGGKSSGGKTGADGHNKKQQSHSARAGLQFPCGRVKRFLKQNTQNKMRVGAKAAVYVTAVLEYLTAE
VLELAGNAAKDLKVKRITPRHLQLAIRGDEELDTLIRATIAFGGVLPHINRALLLKVEQKKKAKALEV*
Coding >Ophcf2|03786
ATGCCCGGCGGCAAGGGAAAATCTGCCGGTGGCAAGAGCTCTGGCGGCAAGACGGGCGCAGACGGTCACAACAAG
AAGCAGCAGAGCCATTCTGCTCGCGCTGGGCTACAGTTTCCCTGCGGACGCGTCAAGCGCTTCCTCAAGCAAAAC
ACGCAGAACAAGATGCGCGTCGGCGCCAAGGCAGCCGTCTACGTAACCGCGGTACTCGAATACCTCACGGCCGAG
GTCCTCGAGCTGGCAGGGAACGCCGCCAAGGACCTCAAGGTGAAGCGCATCACCCCGCGCCACCTGCAGCTCGCG
ATTCGAGGCGACGAGGAGCTCGACACGCTGATCCGTGCCACCATTGCCTTTGGAGGCGTACTGCCGCACATCAAC
CGCGCCCTGCTGCTCAAGGTGGAGCAGAAGAAGAAGGCTAAGGCGCTGGAAGTCTGA
Transcript >Ophcf2|03786
ATGCCCGGCGGCAAGGGAAAATCTGCCGGTGGCAAGAGCTCTGGCGGCAAGACGGGCGCAGACGGTCACAACAAG
AAGCAGCAGAGCCATTCTGCTCGCGCTGGGCTACAGTTTCCCTGCGGACGCGTCAAGCGCTTCCTCAAGCAAAAC
ACGCAGAACAAGATGCGCGTCGGCGCCAAGGCAGCCGTCTACGTAACCGCGGTACTCGAATACCTCACGGCCGAG
GTCCTCGAGCTGGCAGGGAACGCCGCCAAGGACCTCAAGGTGAAGCGCATCACCCCGCGCCACCTGCAGCTCGCG
ATTCGAGGCGACGAGGAGCTCGACACGCTGATCCGTGCCACCATTGCCTTTGGAGGCGTACTGCCGCACATCAAC
CGCGCCCTGCTGCTCAAGGTGGAGCAGAAGAAGAAGGCTAAGGCGCTGGAAGTCTGA
Gene >Ophcf2|03786
ATGCCCGGCGGCAAGGGAAAATCTGCCGGTGGCAAGAGCTCTGGCGGCAAGACGGGCGCAGACGGTCACAACAAG
AAGCAGCAGAGCCATTCTGCTCGCGCTGGGCTACAGGTGAGAGCATGCTTTTCCCACCCTACGAGACCCTTTTTT
TTTTTTTTTTCCTTTCTCATCTGCCCCGCGCCCGTGTCGCATCGCGTCGGTTCCAAACGATGACGCTCGCCACGG
GACGCGCCTCATCGATACGCCTTTGAATGGCCAGCTGCGTTCGGCCTACTGATGAACAATCGCGACTGACGCTTG
AAACACAGTTTCCCTGCGGACGCGTCAAGCGCTTCCTCAAGCAAAACACGCAGAACAAGATGCGCGTCGGCGCCA
AGGCAGCCGTCTACGTAACCGCGGTACTCGAATACCTCACGGCCGAGGTCCTCGAGCTGGCAGGGGTTTGTCCCT
CCTCCCCTACCCTCTTTTCCCCCCGGATGACTCACAGGCCACTGACGCTTTGCCCGTCGCAGAACGCCGCCAAGG
ACCTCAAGGTGAAGCGCATCACCCCGCGCCACCTGCAGCTCGCGATTCGAGGCGACGAGGAGCTCGACACGCTGA
TCCGTGCCACCATTGCCTTTGGAGGCGTACTGCCGCACATCAACCGCGCCCTGCTGCTCAAGGTGGAGCAGAAGA
AGAAGGCTAAGGCGCTGGAAGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail