Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03780
Gene name
Locationscaffold_03:3812272..3812727
Strand+
Gene length (bp)455
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0822 0.0696 0.952 0.1965 0.0493 0.003 0.0987 0.0881 0.0383 0.0021

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999345

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.61 0.0 1.73
Alive In ants, during behavior modification 1.75 0.0 3.78
Dead In ants, recently dead 4.15 0.0 8.47

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.209187 no
Alive Dead 0.081454 no
Dead Fungus 0.041731 yes

Orthologs

Orthofinder run ID4
Orthogroup6581
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03780 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5303
Ophiocordyceps subramaniannii Hirsu2|3002

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03780
MFNAAFILALGSTALAGALHDRDGHCGGDNCARQVTGTRSGLVPIETRRADCSSFMAAIPETTTTTVTGADGGYG
YYPPYADPKAATDVPTYAPACRAAGKYSSACSCWGITAPLTRQTKTVTVSTSKPCPYS*
Coding >Ophcf2|03780
ATGTTCAACGCAGCCTTCATCCTCGCTCTCGGCTCCACCGCTCTGGCCGGCGCTCTCCACGACCGTGACGGTCAC
TGCGGAGGCGACAATTGCGCAAGACAGGTGACGGGCACGCGATCTGGCCTCGTCCCCATTGAGACGCGCCGAGCC
GACTGCTCGAGCTTTATGGCAGCAATCCCAGAGACAACCACGACGACTGTCACCGGCGCGGACGGCGGCTATGGC
TACTATCCCCCTTACGCCGACCCCAAGGCAGCCACAGACGTGCCCACATACGCACCAGCCTGTCGGGCAGCGGGC
AAATACTCATCAGCTTGTTCGTGCTGGGGCATCACAGCGCCGCTGACAAGGCAGACGAAGACTGTCACGGTCTCG
ACGTCCAAGCCATGTCCCTACTCGTGA
Transcript >Ophcf2|03780
ATGTTCAACGCAGCCTTCATCCTCGCTCTCGGCTCCACCGCTCTGGCCGGCGCTCTCCACGACCGTGACGGTCAC
TGCGGAGGCGACAATTGCGCAAGACAGGTGACGGGCACGCGATCTGGCCTCGTCCCCATTGAGACGCGCCGAGCC
GACTGCTCGAGCTTTATGGCAGCAATCCCAGAGACAACCACGACGACTGTCACCGGCGCGGACGGCGGCTATGGC
TACTATCCCCCTTACGCCGACCCCAAGGCAGCCACAGACGTGCCCACATACGCACCAGCCTGTCGGGCAGCGGGC
AAATACTCATCAGCTTGTTCGTGCTGGGGCATCACAGCGCCGCTGACAAGGCAGACGAAGACTGTCACGGTCTCG
ACGTCCAAGCCATGTCCCTACTCGTGA
Gene >Ophcf2|03780
ATGTTCAACGCAGCCTTCATCCTCGCTCTCGGCTCCACCGCTCTGGCCGGCGCTCTCCACGACCGTGACGGTCAC
TGCGGAGGCGACAATTGCGCAAGACAGGTGACGGGCACGCGATCTGGCCTCGTCCCCATTGAGACGCGCCGAGCC
GACTGCTCGAGCTTTATGGCAGCAATCCCAGAGACAACGTACGTCTTCTCTTCATGGCAAAAGCATCCGTCAGCG
ACTAACACGTTCGCAGCACGACGACTGTCACCGGCGCGGACGGCGGCTATGGCTACTATCCCCCTTACGCCGACC
CCAAGGCAGCCACAGACGTGCCCACATACGCACCAGCCTGTCGGGCAGCGGGCAAATACTCATCAGCTTGTTCGT
GCTGGGGCATCACAGCGCCGCTGACAAGGCAGACGAAGACTGTCACGGTCTCGACGTCCAAGCCATGTCCCTACT
CGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail