Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03771
Gene name
Locationscaffold_03:3780192..3781858
Strand+
Gene length (bp)1666
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 7.2E-53 149 418
PF13649 Methyltransf_25 Methyltransferase domain 1.6E-15 201 297
PF08241 Methyltransf_11 Methyltransferase domain 1.1E-11 202 297
PF13489 Methyltransf_23 Methyltransferase domain 1.6E-07 182 334
PF13847 Methyltransf_31 Methyltransferase domain 6.0E-07 196 306

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4902 0.3242 0.1056 0.0483 0.2986 0.0546 0.1618 0.2305 0.3479 0.0149

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3219
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4165
Ophiocordyceps australis map64 (Brazil) OphauB2|6415
Ophiocordyceps camponoti-floridani Ophcf2|03771 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4737
Ophiocordyceps kimflemingae Ophio5|7494
Ophiocordyceps subramaniannii Hirsu2|58

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03771
MESPPSPYDNKMTMTEAWLQSLARRLVCRSLDRFRQFQVRLRFRHLGPDEPDVLVGQPGDEEPVVLIVDDFRFYA
RFLLSMELGMAEALMLGEVRCSDLVRLSCRYKTNIDAFGSNGFTTHMIRLLATLCLDKGKTLDRLRQSLISDPDE
PNEVFTNILSNDMNFSSALWSGESDESLESAQRRKVQTIIDKASISSSHHVLDIGCGWGNLAIEAARRTGCRVTG
VTLSTQEKLFAEARIRAAGLHDKIRIVVCDYRRVPRVKGGYDRVISVEMLQYVARHSIRAFFGEVSDLLKPQTGV
VVTQAITTHKNSSSDTYAESFLARYIFPRGHLHTIHELLTAMNDGSDGQLEVETVESIGPHYVRTLQHWQNNLET
NWLSTREALLKTMPDADEDLIEAYRRRWECFLSYFQAGFRTRWLGNYILSAGRPFSSGNRWRVASTSEPDRAIDT
FLTRDPAAV*
Coding >Ophcf2|03771
ATGGAATCGCCTCCGTCGCCGTACGACAACAAGATGACCATGACGGAAGCCTGGCTGCAGTCACTCGCCCGACGA
CTCGTCTGCCGATCCCTTGACCGCTTTCGCCAGTTTCAGGTCCGGTTGAGATTCCGACATCTGGGTCCCGATGAG
CCCGACGTGCTGGTCGGGCAGCCCGGGGATGAAGAGCCCGTCGTCTTGATCGTCGACGATTTCCGCTTCTACGCC
AGGTTTCTCCTGTCGATGGAGCTGGGAATGGCAGAAGCCTTAATGCTGGGGGAGGTTCGTTGCTCTGACCTCGTC
CGCCTATCTTGTCGGTACAAGACAAATATAGATGCCTTCGGCTCCAACGGCTTCACCACGCACATGATACGTCTG
CTGGCCACTCTTTGCTTGGACAAGGGCAAGACTCTAGACAGGTTGCGTCAAAGCCTCATATCCGATCCCGACGAG
CCGAACGAAGTCTTCACCAATATCCTATCCAACGACATGAACTTCTCATCGGCGCTCTGGTCCGGCGAGAGCGAC
GAATCCCTCGAATCGGCACAGCGGCGCAAGGTTCAGACCATCATCGACAAGGCCTCCATCTCGTCTTCCCACCAC
GTGCTCGATATCGGATGCGGATGGGGCAACCTGGCCATCGAGGCAGCCAGACGAACAGGGTGCAGGGTCACGGGT
GTGACGCTTTCGACGCAGGAGAAGCTCTTTGCCGAGGCTCGCATCCGGGCTGCCGGCCTGCATGACAAGATTCGC
ATCGTCGTCTGCGACTATCGGAGAGTGCCCAGGGTGAAAGGGGGCTACGATCGCGTCATCTCCGTCGAGATGCTG
CAATACGTGGCCCGTCACTCCATCAGGGCTTTCTTCGGCGAGGTTTCTGACCTCTTGAAGCCTCAGACGGGCGTC
GTGGTGACGCAGGCCATCACCACTCACAAGAATTCGTCTTCGGACACCTACGCAGAGAGCTTCCTCGCCCGCTAC
ATCTTTCCCCGAGGCCATCTCCATACGATCCACGAGCTGCTTACGGCCATGAACGACGGATCAGACGGACAGCTC
GAGGTCGAAACCGTCGAGAGCATAGGGCCGCATTATGTGCGGACGCTGCAACACTGGCAAAACAATCTCGAGACC
AACTGGCTCTCTACGAGGGAAGCCTTGCTCAAGACCATGCCGGATGCCGACGAGGACCTCATAGAGGCCTATCGT
CGGAGGTGGGAGTGCTTCTTGAGTTACTTCCAAGCTGGCTTCCGCACCCGCTGGCTCGGCAACTATATTCTTTCG
GCTGGGCGGCCTTTTTCGAGCGGAAACCGTTGGCGGGTGGCTTCCACATCTGAGCCGGATCGAGCCATAGACACG
TTTCTGACGCGAGATCCCGCTGCCGTATAA
Transcript >Ophcf2|03771
ATGGAATCGCCTCCGTCGCCGTACGACAACAAGATGACCATGACGGAAGCCTGGCTGCAGTCACTCGCCCGACGA
CTCGTCTGCCGATCCCTTGACCGCTTTCGCCAGTTTCAGGTCCGGTTGAGATTCCGACATCTGGGTCCCGATGAG
CCCGACGTGCTGGTCGGGCAGCCCGGGGATGAAGAGCCCGTCGTCTTGATCGTCGACGATTTCCGCTTCTACGCC
AGGTTTCTCCTGTCGATGGAGCTGGGAATGGCAGAAGCCTTAATGCTGGGGGAGGTTCGTTGCTCTGACCTCGTC
CGCCTATCTTGTCGGTACAAGACAAATATAGATGCCTTCGGCTCCAACGGCTTCACCACGCACATGATACGTCTG
CTGGCCACTCTTTGCTTGGACAAGGGCAAGACTCTAGACAGGTTGCGTCAAAGCCTCATATCCGATCCCGACGAG
CCGAACGAAGTCTTCACCAATATCCTATCCAACGACATGAACTTCTCATCGGCGCTCTGGTCCGGCGAGAGCGAC
GAATCCCTCGAATCGGCACAGCGGCGCAAGGTTCAGACCATCATCGACAAGGCCTCCATCTCGTCTTCCCACCAC
GTGCTCGATATCGGATGCGGATGGGGCAACCTGGCCATCGAGGCAGCCAGACGAACAGGGTGCAGGGTCACGGGT
GTGACGCTTTCGACGCAGGAGAAGCTCTTTGCCGAGGCTCGCATCCGGGCTGCCGGCCTGCATGACAAGATTCGC
ATCGTCGTCTGCGACTATCGGAGAGTGCCCAGGGTGAAAGGGGGCTACGATCGCGTCATCTCCGTCGAGATGCTG
CAATACGTGGCCCGTCACTCCATCAGGGCTTTCTTCGGCGAGGTTTCTGACCTCTTGAAGCCTCAGACGGGCGTC
GTGGTGACGCAGGCCATCACCACTCACAAGAATTCGTCTTCGGACACCTACGCAGAGAGCTTCCTCGCCCGCTAC
ATCTTTCCCCGAGGCCATCTCCATACGATCCACGAGCTGCTTACGGCCATGAACGACGGATCAGACGGACAGCTC
GAGGTCGAAACCGTCGAGAGCATAGGGCCGCATTATGTGCGGACGCTGCAACACTGGCAAAACAATCTCGAGACC
AACTGGCTCTCTACGAGGGAAGCCTTGCTCAAGACCATGCCGGATGCCGACGAGGACCTCATAGAGGCCTATCGT
CGGAGGTGGGAGTGCTTCTTGAGTTACTTCCAAGCTGGCTTCCGCACCCGCTGGCTCGGCAACTATATTCTTTCG
GCTGGGCGGCCTTTTTCGAGCGGAAACCGTTGGCGGGTGGCTTCCACATCTGAGCCGGATCGAGCCATAGACACG
TTTCTGACGCGAGATCCCGCTGCCGTATAA
Gene >Ophcf2|03771
ATGGAATCGCCTCCGTCGCCGTACGACAACAAGATGACCATGACGGAAGCCTGGCTGCAGTCACTCGCCCGACGA
CTCGTCTGCCGATCCCTTGACCGCTTTCGCCAGTTTCAGGTCCGGTTGAGATTCCGACATCTGGGTCCCGATGAG
CCCGACGTGCTGGTCGGGCAGCCCGGGGATGAAGAGCCCGTCGTCTTGATCGTCGACGATTTCCGCTTCTACGCC
AGGTTTCTCCTGTCGATGGAGCTGGTGCGCTGGGCCCTTGCCGGTCTCCCCACTGAACTGTGCTGAGGACGGCGG
TGGGTGCTAGGGAATGGCAGAAGCCTTAATGCTGGGGGAGGTTCGTTGCTCTGACCTCGTCCGCCTATCTTGTGT
GAGCCATTGGATCCATCCCTTTTTGTCCTCGCGACTGTCCTTGCAAGTACAACCCGGATGACTCTGTATTCTTCA
TAGCGGTACAAGACAAATATAGATGCCTTCGGCTCCAACGGCTTCACCACGCACATGATACGTCTGCTGGCCACT
CTTTGCTTGGACAAGGGCAAGACTCTAGACAGGTTGCGTCAAAGCCTCATATCCGATCCCGACGAGCCGAACGAA
GTCTTCACCAATATCCTATCCAACGACATGAACTTCTCATCGGCGCTCTGGTCCGGCGAGAGCGACGAATCCCTC
GAATCGGCACAGCGGCGCAAGGTTCAGACCATCATCGACAAGGCCTCCATCTCGTCTTCCCACCACGTGCTCGAT
ATCGGATGCGGATGGGGCAACCTGGCCATCGAGGCAGCCAGACGAACAGGGTGCAGGGTCACGGGTGTGACGCTT
TCGACGCAGGAGAAGCTCTTTGCCGAGGCTCGCATCCGGGCTGCCGGCCTGCATGACAAGATTCGCATCGTCGTC
TGCGACTATCGGAGAGTGCCCAGGGTGAAAGGGGGCTACGATCGCGTCATCTCCGTCGAGATGCTGCAATACGTG
GCCCGTCACTCCATCAGGGCTTTCTTCGGCGAGGTTTCTGACCTCTTGAAGCCTCAGACGGGCGTCGTGGTGACG
CAGGCCATCACCACTCACAAGTGAGCAATAGCCAAGCCAGTCCATGACCAGCACCCGTCGCTGAACGTAGCCATC
ACGTCCGTACAGGAATTCGTCTTCGGACACCTACGCAGAGAGCTTCCTCGCCCGCTACATCTTTCCCCGAGGCCA
TCTCCATACGATCCACGAGCTGCTTACGGCCATGAACGACGGATCAGACGGACAGCTCGAGGTCGAAACCGTCGA
GAGCATAGGGCCGCATTATGTGCGGACGCTGCAACACTGGCAAAACAATCTCGAGACCAACTGGCTCTCTACGAG
GGAAGCCTTGCTCAAGACCATGCCGGATGCCGACGAGGACCTCATAGAGGCCTATCGTCGGAGGTGGGAGGTAAG
TCTCGTCTCCTTTAAAAAAAAAAAAAAAAAAAAAGTCCTGATGAGATTCGCTGAAACGGGCGGGCGGACGCAGTG
CTTCTTGAGTTACTTCCAAGCTGGCTTCCGCACCCGCTGGCTCGGCAACTATATTCTTTCGGCTGGGCGGCCTTT
TTCGAGCGGAAACCGTTGGCGGGTGGCTTCCACATCTGAGCCGGATCGAGCCATAGACACGTTTCTGACGCGAGA
TCCCGCTGCCGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail