Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03766
Gene name
Locationscaffold_03:3771185..3774293
Strand+
Gene length (bp)3108
Transcript length (bp)3108
Coding sequence length (bp)3108
Protein length (aa) 1036

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.4E-43 747 953

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6014 0.2483 0.1155 0.2152 0.0678 0.0067 0.1487 0.3332 0.4329 0.0243

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3131
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2828
Ophiocordyceps australis map64 (Brazil) OphauB2|2909
Ophiocordyceps camponoti-floridani Ophcf2|03766 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5300
Ophiocordyceps kimflemingae Ophio5|7502
Ophiocordyceps subramaniannii Hirsu2|5499

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03766
MAADAPQETGPACLALERSISQHSAASGRSHRSGRRHSKNRKLLSQPSSSASSIAPSDKSLTSFPSFSPDSPDVE
RFDDEPTARLKVPTQQADSRSIVDSLTGSGSARDALFEDSPLRQFIPGALHRADDDHIQRLVARHGAVALVRQIA
EDLAHRDAQIASLRRRTDERERALRRIVRECGVSSLELETKLRSVEAELRANDRTQGSDNGALSDLMSDAMRDTV
AENAYGETGRATSSTIRASSASFGATANASSTANDGSGKGGTMKAWKDYLWGAGTAKKTGARTANSVNGDASRHA
SATVVRSHSSMDRRPTLQEDLFDPPAASDPASPRSVSRASSVRSGDASDRKPSTSLASLALRLVAGGAAPTRDAS
ARDRGPSNSGDGGPARFGSTASSTKTVQSSRATSGGGGPRALMAMRRSAPSPQAAAIGLKPQTQDANAPGRPPGP
QESHGPVEMDAILPPESQPPTLTSYHNQCASDEYLTDRFGFIYDQRRKKRQREAAHMAQLGGALSGRAEMLVNGI
SAEEVSGAGCSAPSDGRPESPSSTDEAKPKRWQDYLRIATFPTELLSHTPSVSLPALEVMEGAETAGQSLKSPAI
MSTSAGLMPPPKTTTAVDSETMTTTRPAPAQATTAATLVKEDAEPVRLLLDQLSDVHDSLQRDKTVKWNDFLRKV
RAERRRDGEAAVAAAAAAAEARYETPAVILPETRVADGEMIGISDLGNKGKVGRAKWSEFKTLVLGGIPVAYRAK
IWSECSGANALRVPGHYEDLVARSGEGDDPAVVGQIQMDIRRTLTDNIFFRKGPGVRKLDEVLLAYSRRNREVGY
CQGMNLIAANLLLMTPSAEDAFWLLASVIENILPQGYYDHLLMPSRADQVVLRQYVSTVLPKLSAHLDSLSIELE
ALTFQWFLSVFTDCLCAEALFRVWDVVLCTNDGSTFLFQVALALLKLNEANLLQCDTPAGVYTYINHHMTEHAIS
IDGLLQASEGLRRVVRRDEVEQRRARAMEAERELTAQRGVVVINETNGGTPADAAGPTEA*
Coding >Ophcf2|03766
ATGGCCGCCGACGCGCCACAGGAGACGGGCCCTGCCTGCCTCGCCCTCGAGCGGTCCATCTCCCAGCACAGCGCC
GCCTCGGGCCGCTCCCACCGTAGTGGCAGGCGTCACAGCAAGAACCGCAAGCTCCTGAGCCAGCCCAGCAGCTCG
GCCAGCAGCATCGCCCCCAGCGACAAGAGTCTCACCAGCTTCCCCAGCTTCTCACCCGACTCCCCAGACGTTGAA
CGCTTCGACGACGAGCCCACGGCTCGACTCAAGGTTCCCACACAGCAGGCCGATAGCCGTTCCATAGTCGATAGC
CTCACGGGCTCCGGCTCGGCTCGCGATGCGCTCTTCGAGGATTCCCCGCTGCGACAGTTTATTCCGGGGGCGCTG
CACCGGGCAGACGACGATCACATCCAGCGTCTGGTCGCCCGCCACGGGGCCGTCGCCCTCGTTCGCCAGATCGCC
GAGGACTTGGCTCATCGCGACGCCCAGATCGCCTCCTTGCGCCGTAGGACCGACGAGCGCGAGCGAGCCCTGAGG
AGGATCGTTCGCGAATGCGGCGTCTCCAGCCTCGAACTCGAAACGAAGCTACGATCTGTCGAAGCCGAGCTCCGT
GCCAACGATCGGACCCAGGGCTCGGACAACGGGGCGCTGAGCGATCTCATGAGCGACGCCATGCGCGATACCGTC
GCCGAGAACGCGTACGGCGAAACGGGTCGCGCGACCAGCTCCACCATCCGCGCAAGCAGCGCCTCTTTTGGCGCC
ACCGCCAACGCTTCCAGCACCGCCAATGATGGCAGCGGCAAGGGGGGCACCATGAAGGCCTGGAAGGACTACCTC
TGGGGAGCGGGCACCGCCAAGAAAACAGGAGCTCGTACCGCCAACAGTGTCAACGGCGACGCCTCACGCCACGCT
TCGGCCACGGTGGTCCGGTCACACTCGAGCATGGACCGGCGTCCGACGCTTCAGGAGGATCTGTTTGATCCCCCA
GCAGCGTCGGACCCCGCCTCGCCGCGCAGCGTCAGTCGCGCATCGAGCGTCAGATCGGGCGACGCTTCGGATCGC
AAGCCATCGACCTCGCTGGCCAGCCTTGCGCTGAGGCTCGTAGCCGGTGGGGCCGCACCTACGCGCGACGCCTCT
GCCCGAGATCGGGGCCCGAGCAATTCCGGCGACGGCGGACCGGCCCGGTTCGGCTCGACGGCCTCCAGCACCAAG
ACGGTGCAGTCGAGTCGCGCGACGTCCGGCGGCGGGGGTCCTCGGGCACTTATGGCAATGCGGCGTTCGGCACCC
TCTCCTCAGGCGGCGGCTATCGGCCTCAAACCGCAGACACAGGACGCCAATGCACCGGGCCGCCCGCCCGGGCCG
CAGGAGAGCCATGGGCCCGTCGAGATGGACGCGATACTGCCTCCCGAGTCTCAGCCTCCGACGCTGACGAGTTAT
CATAACCAATGCGCCTCGGACGAATACTTGACGGATCGCTTCGGCTTCATCTACGACCAGCGACGCAAGAAACGG
CAGCGCGAGGCGGCCCACATGGCTCAGCTCGGCGGTGCCTTGTCGGGACGGGCCGAGATGCTCGTCAACGGTATC
TCAGCGGAGGAAGTGTCAGGCGCCGGCTGCTCCGCCCCGAGCGACGGCCGGCCGGAGAGCCCGAGCAGCACCGAC
GAGGCGAAGCCGAAGCGATGGCAGGACTATCTGCGTATCGCCACCTTTCCCACCGAGCTACTCAGCCACACACCA
AGCGTCAGCCTGCCGGCGCTCGAAGTCATGGAGGGCGCCGAGACGGCGGGCCAGTCGCTCAAATCACCCGCAATC
ATGTCGACGAGCGCAGGTCTCATGCCGCCGCCCAAGACGACGACGGCCGTCGACAGCGAGACAATGACTACGACG
CGGCCCGCGCCGGCGCAGGCCACGACGGCGGCGACGCTGGTCAAGGAAGACGCTGAGCCGGTGCGGCTCCTGCTG
GACCAGCTGAGCGACGTGCACGACTCGCTGCAGCGGGACAAGACGGTCAAGTGGAACGACTTCTTGCGCAAGGTG
CGGGCCGAGCGCCGGCGCGATGGCGAGGCCGCCGTAGCCGCCGCTGCCGCCGCCGCCGAGGCGCGGTACGAGACG
CCGGCCGTGATCTTGCCTGAGACGCGCGTGGCCGACGGCGAGATGATTGGCATCTCGGACCTCGGCAATAAGGGC
AAGGTCGGGAGGGCCAAATGGAGCGAGTTCAAGACGCTCGTGCTCGGTGGCATCCCCGTCGCCTACCGAGCCAAG
ATCTGGTCCGAGTGCTCAGGCGCAAACGCGCTGCGCGTCCCGGGTCACTACGAGGACCTGGTGGCCCGCAGCGGC
GAAGGCGACGACCCGGCCGTGGTGGGCCAGATCCAGATGGATATCCGGCGCACGCTGACGGACAACATCTTCTTC
CGGAAGGGGCCCGGTGTGCGGAAGCTGGACGAGGTGCTGCTGGCCTATTCGCGCCGCAACCGCGAGGTGGGTTAC
TGTCAGGGCATGAACCTGATCGCGGCCAACCTGCTGCTGATGACGCCTTCGGCCGAGGATGCCTTCTGGCTGCTG
GCGTCGGTCATCGAAAATATCCTACCGCAGGGCTACTACGATCACCTGCTGATGCCCTCGCGCGCCGATCAGGTG
GTGCTGCGGCAGTACGTGTCGACGGTGCTGCCGAAGTTGTCGGCCCACCTCGACTCGCTCTCGATCGAGCTCGAG
GCGCTGACGTTTCAGTGGTTCCTCTCAGTCTTCACCGACTGCCTGTGCGCCGAGGCCTTGTTCCGAGTCTGGGAT
GTGGTGCTGTGTACCAACGACGGCAGCACGTTTCTCTTCCAGGTCGCCCTGGCGCTGCTCAAGCTCAACGAGGCG
AACTTGCTGCAGTGCGACACTCCGGCCGGAGTGTACACTTACATCAACCATCACATGACGGAGCACGCCATCAGC
ATCGACGGTCTGCTGCAGGCCAGCGAGGGTCTGCGCCGCGTCGTCCGTCGCGACGAGGTCGAGCAGCGCAGGGCC
AGAGCCATGGAGGCCGAGAGGGAGCTTACGGCCCAGCGGGGCGTGGTCGTCATCAACGAGACCAACGGAGGGACC
CCGGCTGATGCGGCGGGGCCGACGGAGGCCTGA
Transcript >Ophcf2|03766
ATGGCCGCCGACGCGCCACAGGAGACGGGCCCTGCCTGCCTCGCCCTCGAGCGGTCCATCTCCCAGCACAGCGCC
GCCTCGGGCCGCTCCCACCGTAGTGGCAGGCGTCACAGCAAGAACCGCAAGCTCCTGAGCCAGCCCAGCAGCTCG
GCCAGCAGCATCGCCCCCAGCGACAAGAGTCTCACCAGCTTCCCCAGCTTCTCACCCGACTCCCCAGACGTTGAA
CGCTTCGACGACGAGCCCACGGCTCGACTCAAGGTTCCCACACAGCAGGCCGATAGCCGTTCCATAGTCGATAGC
CTCACGGGCTCCGGCTCGGCTCGCGATGCGCTCTTCGAGGATTCCCCGCTGCGACAGTTTATTCCGGGGGCGCTG
CACCGGGCAGACGACGATCACATCCAGCGTCTGGTCGCCCGCCACGGGGCCGTCGCCCTCGTTCGCCAGATCGCC
GAGGACTTGGCTCATCGCGACGCCCAGATCGCCTCCTTGCGCCGTAGGACCGACGAGCGCGAGCGAGCCCTGAGG
AGGATCGTTCGCGAATGCGGCGTCTCCAGCCTCGAACTCGAAACGAAGCTACGATCTGTCGAAGCCGAGCTCCGT
GCCAACGATCGGACCCAGGGCTCGGACAACGGGGCGCTGAGCGATCTCATGAGCGACGCCATGCGCGATACCGTC
GCCGAGAACGCGTACGGCGAAACGGGTCGCGCGACCAGCTCCACCATCCGCGCAAGCAGCGCCTCTTTTGGCGCC
ACCGCCAACGCTTCCAGCACCGCCAATGATGGCAGCGGCAAGGGGGGCACCATGAAGGCCTGGAAGGACTACCTC
TGGGGAGCGGGCACCGCCAAGAAAACAGGAGCTCGTACCGCCAACAGTGTCAACGGCGACGCCTCACGCCACGCT
TCGGCCACGGTGGTCCGGTCACACTCGAGCATGGACCGGCGTCCGACGCTTCAGGAGGATCTGTTTGATCCCCCA
GCAGCGTCGGACCCCGCCTCGCCGCGCAGCGTCAGTCGCGCATCGAGCGTCAGATCGGGCGACGCTTCGGATCGC
AAGCCATCGACCTCGCTGGCCAGCCTTGCGCTGAGGCTCGTAGCCGGTGGGGCCGCACCTACGCGCGACGCCTCT
GCCCGAGATCGGGGCCCGAGCAATTCCGGCGACGGCGGACCGGCCCGGTTCGGCTCGACGGCCTCCAGCACCAAG
ACGGTGCAGTCGAGTCGCGCGACGTCCGGCGGCGGGGGTCCTCGGGCACTTATGGCAATGCGGCGTTCGGCACCC
TCTCCTCAGGCGGCGGCTATCGGCCTCAAACCGCAGACACAGGACGCCAATGCACCGGGCCGCCCGCCCGGGCCG
CAGGAGAGCCATGGGCCCGTCGAGATGGACGCGATACTGCCTCCCGAGTCTCAGCCTCCGACGCTGACGAGTTAT
CATAACCAATGCGCCTCGGACGAATACTTGACGGATCGCTTCGGCTTCATCTACGACCAGCGACGCAAGAAACGG
CAGCGCGAGGCGGCCCACATGGCTCAGCTCGGCGGTGCCTTGTCGGGACGGGCCGAGATGCTCGTCAACGGTATC
TCAGCGGAGGAAGTGTCAGGCGCCGGCTGCTCCGCCCCGAGCGACGGCCGGCCGGAGAGCCCGAGCAGCACCGAC
GAGGCGAAGCCGAAGCGATGGCAGGACTATCTGCGTATCGCCACCTTTCCCACCGAGCTACTCAGCCACACACCA
AGCGTCAGCCTGCCGGCGCTCGAAGTCATGGAGGGCGCCGAGACGGCGGGCCAGTCGCTCAAATCACCCGCAATC
ATGTCGACGAGCGCAGGTCTCATGCCGCCGCCCAAGACGACGACGGCCGTCGACAGCGAGACAATGACTACGACG
CGGCCCGCGCCGGCGCAGGCCACGACGGCGGCGACGCTGGTCAAGGAAGACGCTGAGCCGGTGCGGCTCCTGCTG
GACCAGCTGAGCGACGTGCACGACTCGCTGCAGCGGGACAAGACGGTCAAGTGGAACGACTTCTTGCGCAAGGTG
CGGGCCGAGCGCCGGCGCGATGGCGAGGCCGCCGTAGCCGCCGCTGCCGCCGCCGCCGAGGCGCGGTACGAGACG
CCGGCCGTGATCTTGCCTGAGACGCGCGTGGCCGACGGCGAGATGATTGGCATCTCGGACCTCGGCAATAAGGGC
AAGGTCGGGAGGGCCAAATGGAGCGAGTTCAAGACGCTCGTGCTCGGTGGCATCCCCGTCGCCTACCGAGCCAAG
ATCTGGTCCGAGTGCTCAGGCGCAAACGCGCTGCGCGTCCCGGGTCACTACGAGGACCTGGTGGCCCGCAGCGGC
GAAGGCGACGACCCGGCCGTGGTGGGCCAGATCCAGATGGATATCCGGCGCACGCTGACGGACAACATCTTCTTC
CGGAAGGGGCCCGGTGTGCGGAAGCTGGACGAGGTGCTGCTGGCCTATTCGCGCCGCAACCGCGAGGTGGGTTAC
TGTCAGGGCATGAACCTGATCGCGGCCAACCTGCTGCTGATGACGCCTTCGGCCGAGGATGCCTTCTGGCTGCTG
GCGTCGGTCATCGAAAATATCCTACCGCAGGGCTACTACGATCACCTGCTGATGCCCTCGCGCGCCGATCAGGTG
GTGCTGCGGCAGTACGTGTCGACGGTGCTGCCGAAGTTGTCGGCCCACCTCGACTCGCTCTCGATCGAGCTCGAG
GCGCTGACGTTTCAGTGGTTCCTCTCAGTCTTCACCGACTGCCTGTGCGCCGAGGCCTTGTTCCGAGTCTGGGAT
GTGGTGCTGTGTACCAACGACGGCAGCACGTTTCTCTTCCAGGTCGCCCTGGCGCTGCTCAAGCTCAACGAGGCG
AACTTGCTGCAGTGCGACACTCCGGCCGGAGTGTACACTTACATCAACCATCACATGACGGAGCACGCCATCAGC
ATCGACGGTCTGCTGCAGGCCAGCGAGGGTCTGCGCCGCGTCGTCCGTCGCGACGAGGTCGAGCAGCGCAGGGCC
AGAGCCATGGAGGCCGAGAGGGAGCTTACGGCCCAGCGGGGCGTGGTCGTCATCAACGAGACCAACGGAGGGACC
CCGGCTGATGCGGCGGGGCCGACGGAGGCCTGA
Gene >Ophcf2|03766
ATGGCCGCCGACGCGCCACAGGAGACGGGCCCTGCCTGCCTCGCCCTCGAGCGGTCCATCTCCCAGCACAGCGCC
GCCTCGGGCCGCTCCCACCGTAGTGGCAGGCGTCACAGCAAGAACCGCAAGCTCCTGAGCCAGCCCAGCAGCTCG
GCCAGCAGCATCGCCCCCAGCGACAAGAGTCTCACCAGCTTCCCCAGCTTCTCACCCGACTCCCCAGACGTTGAA
CGCTTCGACGACGAGCCCACGGCTCGACTCAAGGTTCCCACACAGCAGGCCGATAGCCGTTCCATAGTCGATAGC
CTCACGGGCTCCGGCTCGGCTCGCGATGCGCTCTTCGAGGATTCCCCGCTGCGACAGTTTATTCCGGGGGCGCTG
CACCGGGCAGACGACGATCACATCCAGCGTCTGGTCGCCCGCCACGGGGCCGTCGCCCTCGTTCGCCAGATCGCC
GAGGACTTGGCTCATCGCGACGCCCAGATCGCCTCCTTGCGCCGTAGGACCGACGAGCGCGAGCGAGCCCTGAGG
AGGATCGTTCGCGAATGCGGCGTCTCCAGCCTCGAACTCGAAACGAAGCTACGATCTGTCGAAGCCGAGCTCCGT
GCCAACGATCGGACCCAGGGCTCGGACAACGGGGCGCTGAGCGATCTCATGAGCGACGCCATGCGCGATACCGTC
GCCGAGAACGCGTACGGCGAAACGGGTCGCGCGACCAGCTCCACCATCCGCGCAAGCAGCGCCTCTTTTGGCGCC
ACCGCCAACGCTTCCAGCACCGCCAATGATGGCAGCGGCAAGGGGGGCACCATGAAGGCCTGGAAGGACTACCTC
TGGGGAGCGGGCACCGCCAAGAAAACAGGAGCTCGTACCGCCAACAGTGTCAACGGCGACGCCTCACGCCACGCT
TCGGCCACGGTGGTCCGGTCACACTCGAGCATGGACCGGCGTCCGACGCTTCAGGAGGATCTGTTTGATCCCCCA
GCAGCGTCGGACCCCGCCTCGCCGCGCAGCGTCAGTCGCGCATCGAGCGTCAGATCGGGCGACGCTTCGGATCGC
AAGCCATCGACCTCGCTGGCCAGCCTTGCGCTGAGGCTCGTAGCCGGTGGGGCCGCACCTACGCGCGACGCCTCT
GCCCGAGATCGGGGCCCGAGCAATTCCGGCGACGGCGGACCGGCCCGGTTCGGCTCGACGGCCTCCAGCACCAAG
ACGGTGCAGTCGAGTCGCGCGACGTCCGGCGGCGGGGGTCCTCGGGCACTTATGGCAATGCGGCGTTCGGCACCC
TCTCCTCAGGCGGCGGCTATCGGCCTCAAACCGCAGACACAGGACGCCAATGCACCGGGCCGCCCGCCCGGGCCG
CAGGAGAGCCATGGGCCCGTCGAGATGGACGCGATACTGCCTCCCGAGTCTCAGCCTCCGACGCTGACGAGTTAT
CATAACCAATGCGCCTCGGACGAATACTTGACGGATCGCTTCGGCTTCATCTACGACCAGCGACGCAAGAAACGG
CAGCGCGAGGCGGCCCACATGGCTCAGCTCGGCGGTGCCTTGTCGGGACGGGCCGAGATGCTCGTCAACGGTATC
TCAGCGGAGGAAGTGTCAGGCGCCGGCTGCTCCGCCCCGAGCGACGGCCGGCCGGAGAGCCCGAGCAGCACCGAC
GAGGCGAAGCCGAAGCGATGGCAGGACTATCTGCGTATCGCCACCTTTCCCACCGAGCTACTCAGCCACACACCA
AGCGTCAGCCTGCCGGCGCTCGAAGTCATGGAGGGCGCCGAGACGGCGGGCCAGTCGCTCAAATCACCCGCAATC
ATGTCGACGAGCGCAGGTCTCATGCCGCCGCCCAAGACGACGACGGCCGTCGACAGCGAGACAATGACTACGACG
CGGCCCGCGCCGGCGCAGGCCACGACGGCGGCGACGCTGGTCAAGGAAGACGCTGAGCCGGTGCGGCTCCTGCTG
GACCAGCTGAGCGACGTGCACGACTCGCTGCAGCGGGACAAGACGGTCAAGTGGAACGACTTCTTGCGCAAGGTG
CGGGCCGAGCGCCGGCGCGATGGCGAGGCCGCCGTAGCCGCCGCTGCCGCCGCCGCCGAGGCGCGGTACGAGACG
CCGGCCGTGATCTTGCCTGAGACGCGCGTGGCCGACGGCGAGATGATTGGCATCTCGGACCTCGGCAATAAGGGC
AAGGTCGGGAGGGCCAAATGGAGCGAGTTCAAGACGCTCGTGCTCGGTGGCATCCCCGTCGCCTACCGAGCCAAG
ATCTGGTCCGAGTGCTCAGGCGCAAACGCGCTGCGCGTCCCGGGTCACTACGAGGACCTGGTGGCCCGCAGCGGC
GAAGGCGACGACCCGGCCGTGGTGGGCCAGATCCAGATGGATATCCGGCGCACGCTGACGGACAACATCTTCTTC
CGGAAGGGGCCCGGTGTGCGGAAGCTGGACGAGGTGCTGCTGGCCTATTCGCGCCGCAACCGCGAGGTGGGTTAC
TGTCAGGGCATGAACCTGATCGCGGCCAACCTGCTGCTGATGACGCCTTCGGCCGAGGATGCCTTCTGGCTGCTG
GCGTCGGTCATCGAAAATATCCTACCGCAGGGCTACTACGATCACCTGCTGATGCCCTCGCGCGCCGATCAGGTG
GTGCTGCGGCAGTACGTGTCGACGGTGCTGCCGAAGTTGTCGGCCCACCTCGACTCGCTCTCGATCGAGCTCGAG
GCGCTGACGTTTCAGTGGTTCCTCTCAGTCTTCACCGACTGCCTGTGCGCCGAGGCCTTGTTCCGAGTCTGGGAT
GTGGTGCTGTGTACCAACGACGGCAGCACGTTTCTCTTCCAGGTCGCCCTGGCGCTGCTCAAGCTCAACGAGGCG
AACTTGCTGCAGTGCGACACTCCGGCCGGAGTGTACACTTACATCAACCATCACATGACGGAGCACGCCATCAGC
ATCGACGGTCTGCTGCAGGCCAGCGAGGGTCTGCGCCGCGTCGTCCGTCGCGACGAGGTCGAGCAGCGCAGGGCC
AGAGCCATGGAGGCCGAGAGGGAGCTTACGGCCCAGCGGGGCGTGGTCGTCATCAACGAGACCAACGGAGGGACC
CCGGCTGATGCGGCGGGGCCGACGGAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail