Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03761
Gene name
Locationscaffold_03:3754517..3755653
Strand+
Gene length (bp)1136
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 3.0E-07 244 356

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0944 0.0583 0.9687 0.0825 0.0876 0.0144 0.124 0.1868 0.1004 0.0017

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999734

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6641
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03761 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3304
Ophiocordyceps kimflemingae Ophio5|7507
Ophiocordyceps subramaniannii Hirsu2|4565

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03761
MGSLSWILALLMATAVTAAPTKESMCITHRGPKLTPEQPGKANNMTKRQVPHNNGGNIVFDIAFHICGDRGQLQP
AVSRQLELTNQHFAHSGSKISFKAIEFTSLPQGCEQWRIDDEPRRNMVMNQIKMSRRRGNGQQHPGGHPGGFPGG
HPGGFPGGHPGGHPGGHPGGFPGGFPGGFPGGFPGGFPGGHPGGFPGGHPGGFPGFQPQRGDSAIIDILVLTTPP
RNPWTNPQGSSGLLGVCDLASAGYASRGCSILVTTLSSIGDPRQASVEGQGVALTHEIGHFMGLKHTFPERNSPH
AGVCGEFDGFSDTAPQRAPTGFAACPNKRNTSPGPAGEQGQCQCTPGANANNMMDYS*
Coding >Ophcf2|03761
ATGGGCTCCCTCTCTTGGATCTTGGCCTTGCTTATGGCCACGGCCGTGACGGCCGCTCCAACAAAAGAGTCGATG
TGCATCACTCACAGAGGGCCCAAGCTGACGCCGGAGCAGCCGGGGAAGGCGAATAACATGACCAAACGTCAAGTT
CCCCATAACAACGGCGGGAACATCGTCTTCGACATTGCCTTTCACATTTGTGGCGACAGAGGGCAGCTGCAGCCT
GCTGTGTCTCGTCAGCTCGAGTTGACCAACCAGCATTTCGCGCATTCGGGCTCCAAGATCTCCTTCAAGGCCATC
GAGTTCACAAGTCTGCCTCAGGGCTGTGAACAATGGCGTATCGATGACGAGCCACGACGGAACATGGTGATGAAC
CAGATCAAGATGAGCCGCCGGAGAGGCAACGGCCAGCAACATCCCGGCGGACACCCGGGCGGATTCCCCGGCGGC
CATCCCGGTGGATTCCCCGGCGGACATCCAGGCGGACATCCAGGCGGACATCCAGGCGGATTCCCCGGCGGATTT
CCCGGTGGATTCCCCGGCGGTTTCCCCGGTGGATTCCCCGGCGGCCATCCCGGTGGATTCCCCGGCGGACATCCC
GGCGGCTTCCCTGGATTCCAACCTCAAAGGGGCGACTCGGCCATCATCGACATCCTGGTTCTGACCACGCCTCCG
CGAAACCCGTGGACGAACCCGCAAGGTAGCTCAGGCCTACTGGGAGTCTGCGATCTAGCCTCCGCCGGCTACGCA
AGCCGCGGATGCTCCATCCTCGTAACAACGCTTTCAAGCATCGGAGACCCTCGACAGGCATCCGTCGAGGGCCAA
GGCGTCGCCCTGACGCACGAGATCGGCCACTTCATGGGTCTCAAGCATACCTTTCCCGAAAGAAATAGCCCACAT
GCGGGAGTCTGCGGCGAATTTGACGGCTTCAGCGACACAGCGCCGCAGAGGGCTCCGACGGGATTCGCTGCTTGC
CCTAACAAGAGGAACACGTCGCCTGGCCCGGCTGGTGAGCAAGGGCAGTGCCAATGCACGCCTGGGGCGAATGCG
AACAACATGATGGACTACTCGTGA
Transcript >Ophcf2|03761
ATGGGCTCCCTCTCTTGGATCTTGGCCTTGCTTATGGCCACGGCCGTGACGGCCGCTCCAACAAAAGAGTCGATG
TGCATCACTCACAGAGGGCCCAAGCTGACGCCGGAGCAGCCGGGGAAGGCGAATAACATGACCAAACGTCAAGTT
CCCCATAACAACGGCGGGAACATCGTCTTCGACATTGCCTTTCACATTTGTGGCGACAGAGGGCAGCTGCAGCCT
GCTGTGTCTCGTCAGCTCGAGTTGACCAACCAGCATTTCGCGCATTCGGGCTCCAAGATCTCCTTCAAGGCCATC
GAGTTCACAAGTCTGCCTCAGGGCTGTGAACAATGGCGTATCGATGACGAGCCACGACGGAACATGGTGATGAAC
CAGATCAAGATGAGCCGCCGGAGAGGCAACGGCCAGCAACATCCCGGCGGACACCCGGGCGGATTCCCCGGCGGC
CATCCCGGTGGATTCCCCGGCGGACATCCAGGCGGACATCCAGGCGGACATCCAGGCGGATTCCCCGGCGGATTT
CCCGGTGGATTCCCCGGCGGTTTCCCCGGTGGATTCCCCGGCGGCCATCCCGGTGGATTCCCCGGCGGACATCCC
GGCGGCTTCCCTGGATTCCAACCTCAAAGGGGCGACTCGGCCATCATCGACATCCTGGTTCTGACCACGCCTCCG
CGAAACCCGTGGACGAACCCGCAAGGTAGCTCAGGCCTACTGGGAGTCTGCGATCTAGCCTCCGCCGGCTACGCA
AGCCGCGGATGCTCCATCCTCGTAACAACGCTTTCAAGCATCGGAGACCCTCGACAGGCATCCGTCGAGGGCCAA
GGCGTCGCCCTGACGCACGAGATCGGCCACTTCATGGGTCTCAAGCATACCTTTCCCGAAAGAAATAGCCCACAT
GCGGGAGTCTGCGGCGAATTTGACGGCTTCAGCGACACAGCGCCGCAGAGGGCTCCGACGGGATTCGCTGCTTGC
CCTAACAAGAGGAACACGTCGCCTGGCCCGGCTGGTGAGCAAGGGCAGTGCCAATGCACGCCTGGGGCGAATGCG
AACAACATGATGGACTACTCGTGA
Gene >Ophcf2|03761
ATGGGCTCCCTCTCTTGGATCTTGGCCTTGCTTATGGCCACGGCCGTGACGGCCGCTCCAACAAAAGAGTCGATG
TGCATCACTCACAGAGGGCCCAAGCTGACGCCGGAGCAGCCGGGGAAGGCGAATAACATGACCAAACGTCAAGTT
CCCCATAACAACGGCGGGAACATCGTCTTCGACATTGCCTTTCACATTTGTGGCGACAGAGGGCAGCTGCAGCCT
GTAAGTTATCTTGAGAAGCTGAGATGAATTATCATAGATACAAGTCGCTAATCTCTGGGCAGGCTGTGTCTCGTC
AGCTCGAGTTGACCAACCAGCATTTCGCGCATTCGGGCTCCAAGATCTCCTTCAAGGCCATCGAGTTCACAAGTC
TGCCTCAGGGCTGTGAACAATGGCGTATCGATGACGAGCCACGACGGAACATGGTGATGAACCAGATCAAGATGA
GCCGCCGGAGAGGCAACGGCCAGCAACATCCCGGCGGACACCCGGGCGGATTCCCCGGCGGCCATCCCGGTGGAT
TCCCCGGCGGACATCCAGGCGGACATCCAGGCGGACATCCAGGCGGATTCCCCGGCGGATTTCCCGGTGGATTCC
CCGGCGGTTTCCCCGGTGGATTCCCCGGCGGCCATCCCGGTGGATTCCCCGGCGGACATCCCGGCGGCTTCCCTG
GATTCCAACCTCAAAGGGGCGACTCGGCCATCATCGACATCCTGGTTCTGACCACGCCTCCGCGAAACCCGTGGA
CGAACCCGCAAGGTAGCTCAGGCCTACTGGGAGTCTGCGATCTAGCCTCCGCCGGCTACGCAAGCCGCGGATGCT
CCATCCTCGTAACAACGCTTTCAAGCATCGGAGACCCTCGACAGGCATCCGTCGAGGGCCAAGGCGTCGCCCTGA
CGCACGAGATCGGCCACTTCATGGGTCTCAAGCATACCTTTCCCGAAAGAAATAGCCCACATGCGGGAGTCTGCG
GCGAATTTGACGGCTTCAGCGACACAGCGCCGCAGAGGGCTCCGACGGGATTCGCTGCTTGCCCTAACAAGAGGA
ACACGTCGCCTGGCCCGGCTGGTGAGCAAGGGCAGTGCCAATGCACGCCTGGGGCGAATGCGAACAACATGATGG
ACTACTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail