Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03757
Gene name
Locationscaffold_03:3744275..3746345
Strand+
Gene length (bp)2070
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 224 246 22
2 259 278 19
3 288 310 22
4 466 488 22
5 492 509 17
6 522 541 19
7 556 578 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 8.54 3.59 13.50
Alive In ants, during behavior modification 30.21 15.62 44.80
Dead In ants, recently dead 20.96 10.81 31.11

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.040382 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03757
MSEPCSCMTSVSLCYRAIQNTVTLRPVPWQASSLVMADDDVPPIMASSRCQPLGKVWTAVGSFAGLVWKWSVPHR
NSHRPGDAVYASVWGGGLSVDGEALRDAVHAAVPDISRKEVPEEEEQIRLFLRERFKQTDGDGETSQESILVETP
EEAWPHIPFSIRSHLAAANASHLEAKLRLLLRESFHPAAGLASLTRSTSGVQKTFRMWRKGFAQAVSWRERVGVN
VFFVVLACSAVYPDIAAGFLGERSYNQRSIGSRIVTLIQLYFLWTFPFHSLWLLFNWSLERLLGAFVGNSVYALV
ALVPAIRVSYRQAWFRTMMLALSMSWQIGVQFSPTIRDYVMRLVVRRQMRALRRKTKTGDEGIDWVSVDEAIARE
LVSQRAFVKQRLNDTLPAWYEVPIKVRTERYIHFTSSMELGRSADQLIGLLKNDLEGIVETLEDYKSTARDGQEV
LTTTDRGHVEPRAPKFLLVLFDVVIFAYVCYSFWTQPFTFNTVVAYSTVVVIKQTILALKRYQTVKGARRLFTNM
VSINILGMLLVSTPVTVDRKVLAKDGNMVALTLAMVFATLFLAEPVAPALLTVTERGVAASSRVIGFTQRTEEES
VMTYDW*
Coding >Ophcf2|03757
ATGTCTGAGCCTTGTTCTTGTATGACGTCTGTCAGCCTATGTTACCGTGCCATTCAGAACACTGTCACCCTACGT
CCAGTCCCTTGGCAAGCCTCATCCCTTGTCATGGCTGACGATGACGTGCCGCCGATCATGGCCTCGAGCAGATGC
CAGCCGCTCGGAAAGGTCTGGACCGCCGTGGGAAGCTTCGCTGGCCTCGTCTGGAAGTGGTCCGTGCCGCACAGA
AACAGTCATCGGCCGGGGGATGCTGTCTATGCTTCTGTCTGGGGTGGGGGGTTGAGCGTCGACGGAGAGGCTCTG
CGTGACGCTGTACACGCTGCGGTGCCTGACATATCTCGAAAGGAGGTGCCGGAAGAGGAGGAGCAAATAAGACTC
TTCCTGAGAGAGCGGTTCAAGCAGACAGACGGCGATGGAGAAACATCACAGGAATCCATCCTTGTTGAAACACCA
GAAGAAGCCTGGCCACACATCCCATTCTCCATCAGAAGCCATCTCGCCGCCGCCAACGCCTCTCATCTCGAGGCC
AAACTGCGTCTCCTCCTCCGGGAAAGCTTCCACCCCGCGGCCGGACTCGCAAGCCTGACGCGTTCGACAAGCGGA
GTGCAGAAGACGTTCCGCATGTGGAGGAAGGGCTTCGCTCAGGCGGTAAGTTGGCGCGAGAGAGTGGGCGTCAAC
GTCTTCTTCGTCGTCCTCGCCTGCAGTGCCGTCTATCCGGACATTGCGGCCGGCTTCCTGGGCGAGCGGTCTTAT
AACCAGCGGTCTATCGGCAGCCGGATCGTGACGCTGATCCAGCTGTACTTTCTCTGGACGTTTCCCTTCCACTCG
CTTTGGCTGCTCTTCAATTGGAGTCTGGAGCGTCTTCTGGGCGCCTTTGTTGGCAACTCGGTCTACGCTTTGGTT
GCCCTAGTGCCGGCGATCCGCGTCTCGTATCGACAAGCCTGGTTCAGGACCATGATGTTGGCGCTCTCCATGAGC
TGGCAGATAGGGGTGCAGTTCTCGCCCACCATTAGAGACTATGTGATGCGTCTGGTCGTCCGGAGGCAGATGCGG
GCTCTGCGGCGGAAGACAAAAACAGGAGACGAGGGCATCGACTGGGTCAGCGTTGACGAGGCCATCGCAAGAGAG
CTCGTCTCTCAAAGGGCCTTTGTCAAACAGCGGCTGAATGATACGCTTCCAGCCTGGTACGAGGTGCCCATCAAA
GTGCGGACAGAGCGCTATATACACTTTACCAGCAGCATGGAGCTCGGCCGCTCGGCCGATCAGCTCATCGGCCTG
CTAAAGAACGACCTGGAGGGCATCGTCGAGACGCTCGAGGACTACAAGTCGACAGCCCGAGACGGCCAGGAGGTC
CTGACGACCACCGACCGAGGGCACGTCGAGCCTCGAGCGCCAAAGTTCCTCCTCGTATTGTTTGACGTCGTCATC
TTTGCCTACGTCTGCTACTCTTTCTGGACGCAGCCCTTTACCTTCAACACCGTCGTAGCCTACAGCACCGTCGTC
GTCATCAAGCAGACGATCCTGGCACTCAAGCGGTACCAGACGGTCAAGGGCGCGCGTCGACTCTTCACAAACATG
GTCTCTATCAACATCCTCGGAATGCTGCTAGTGTCGACGCCCGTGACGGTGGATAGAAAGGTGCTGGCCAAGGAC
GGGAACATGGTGGCTTTGACGCTGGCCATGGTCTTTGCTACCTTGTTTCTGGCTGAGCCTGTTGCTCCGGCTTTG
CTGACGGTGACGGAGAGGGGTGTTGCTGCGTCGTCGAGAGTGATTGGATTCACTCAGCGGACAGAGGAAGAGTCG
GTCATGACTTATGACTGGTAA
Transcript >Ophcf2|03757
ATGTCTGAGCCTTGTTCTTGTATGACGTCTGTCAGCCTATGTTACCGTGCCATTCAGAACACTGTCACCCTACGT
CCAGTCCCTTGGCAAGCCTCATCCCTTGTCATGGCTGACGATGACGTGCCGCCGATCATGGCCTCGAGCAGATGC
CAGCCGCTCGGAAAGGTCTGGACCGCCGTGGGAAGCTTCGCTGGCCTCGTCTGGAAGTGGTCCGTGCCGCACAGA
AACAGTCATCGGCCGGGGGATGCTGTCTATGCTTCTGTCTGGGGTGGGGGGTTGAGCGTCGACGGAGAGGCTCTG
CGTGACGCTGTACACGCTGCGGTGCCTGACATATCTCGAAAGGAGGTGCCGGAAGAGGAGGAGCAAATAAGACTC
TTCCTGAGAGAGCGGTTCAAGCAGACAGACGGCGATGGAGAAACATCACAGGAATCCATCCTTGTTGAAACACCA
GAAGAAGCCTGGCCACACATCCCATTCTCCATCAGAAGCCATCTCGCCGCCGCCAACGCCTCTCATCTCGAGGCC
AAACTGCGTCTCCTCCTCCGGGAAAGCTTCCACCCCGCGGCCGGACTCGCAAGCCTGACGCGTTCGACAAGCGGA
GTGCAGAAGACGTTCCGCATGTGGAGGAAGGGCTTCGCTCAGGCGGTAAGTTGGCGCGAGAGAGTGGGCGTCAAC
GTCTTCTTCGTCGTCCTCGCCTGCAGTGCCGTCTATCCGGACATTGCGGCCGGCTTCCTGGGCGAGCGGTCTTAT
AACCAGCGGTCTATCGGCAGCCGGATCGTGACGCTGATCCAGCTGTACTTTCTCTGGACGTTTCCCTTCCACTCG
CTTTGGCTGCTCTTCAATTGGAGTCTGGAGCGTCTTCTGGGCGCCTTTGTTGGCAACTCGGTCTACGCTTTGGTT
GCCCTAGTGCCGGCGATCCGCGTCTCGTATCGACAAGCCTGGTTCAGGACCATGATGTTGGCGCTCTCCATGAGC
TGGCAGATAGGGGTGCAGTTCTCGCCCACCATTAGAGACTATGTGATGCGTCTGGTCGTCCGGAGGCAGATGCGG
GCTCTGCGGCGGAAGACAAAAACAGGAGACGAGGGCATCGACTGGGTCAGCGTTGACGAGGCCATCGCAAGAGAG
CTCGTCTCTCAAAGGGCCTTTGTCAAACAGCGGCTGAATGATACGCTTCCAGCCTGGTACGAGGTGCCCATCAAA
GTGCGGACAGAGCGCTATATACACTTTACCAGCAGCATGGAGCTCGGCCGCTCGGCCGATCAGCTCATCGGCCTG
CTAAAGAACGACCTGGAGGGCATCGTCGAGACGCTCGAGGACTACAAGTCGACAGCCCGAGACGGCCAGGAGGTC
CTGACGACCACCGACCGAGGGCACGTCGAGCCTCGAGCGCCAAAGTTCCTCCTCGTATTGTTTGACGTCGTCATC
TTTGCCTACGTCTGCTACTCTTTCTGGACGCAGCCCTTTACCTTCAACACCGTCGTAGCCTACAGCACCGTCGTC
GTCATCAAGCAGACGATCCTGGCACTCAAGCGGTACCAGACGGTCAAGGGCGCGCGTCGACTCTTCACAAACATG
GTCTCTATCAACATCCTCGGAATGCTGCTAGTGTCGACGCCCGTGACGGTGGATAGAAAGGTGCTGGCCAAGGAC
GGGAACATGGTGGCTTTGACGCTGGCCATGGTCTTTGCTACCTTGTTTCTGGCTGAGCCTGTTGCTCCGGCTTTG
CTGACGGTGACGGAGAGGGGTGTTGCTGCGTCGTCGAGAGTGATTGGATTCACTCAGCGGACAGAGGAAGAGTCG
GTCATGACTTATGACTGGTAA
Gene >Ophcf2|03757
ATGTCTGAGCCTTGTTCTTGTATGACGTCTGTCAGCCTGTGCGTTGTATCACCCCCAAGCCCGGATCCCTGATCC
CTTGGATCCCCTGAACACGAGCACGAGGTGGACGACCGACTAACAAGTTCCCATCCCGCTTCCCCTCTCCTCATA
AGTAGATGTTACCGTGCCATTCAGAACACTGTCACCCTACGTCCAGTCCCTTGGCAAGCCTCATCCCTTGTCATG
GCTGACGATGACGTGCCGCCGATCATGGCCTCGAGCAGATGCCAGCCGCTCGGAAAGGTCTGGACCGCCGTGGGA
AGCTTCGCTGGCCTCGTCTGGAAGTGGTCCGTGCCGCACAGAAACAGTCATCGGCCGGGGGATGCTGTCTATGCT
TCTGTCTGGGGTGGGGGGTTGAGCGTCGACGGAGAGGCTCTGCGTGACGCTGTACACGCTGCGGTGCCTGACATA
TCTCGAAAGGAGGTGCCGGAAGAGGAGGAGCAAATAAGACTCTTCCTGAGAGAGCGGTTCAAGCAGACAGACGGC
GATGGAGAAACATCACAGGAATCCATCCTTGTTGAAACACCAGAAGAAGCCTGGCCACACATCCCATTCTCCATC
AGAAGCCATCTCGCCGCCGCCAACGCCTCTCATCTCGAGGCCAAACTGCGTCTCCTCCTCCGGGAAAGCTTCCAC
CCCGCGGCCGGACTCGCAAGCCTGACGCGTTCGACAAGCGGAGTGCAGAAGACGTTCCGCATGTGGAGGAAGGGC
TTCGCTCAGGCGGTAAGTTGGCGCGAGAGAGTGGGCGTCAACGTCTTCTTCGTCGTCCTCGCCTGCAGTGCCGTC
TATCCGGACATTGCGGCCGGCTTCCTGGGCGAGCGGTCTTATAACCAGCGGTCTATCGGCAGCCGGATCGTGACG
CTGATCCAGCTGTACTTTCTCTGGACGTTTCCCTTCCACTCGCTTTGGCTGCTCTTCAATTGGAGTCTGGAGCGT
CTTCTGGGCGCCTTTGTTGGCAACTCGGTCTACGCTTTGGTTGCCCTAGTGCCGGCGATCCGCGTCTCGTATCGA
CAAGCCTGGTTCAGGACCATGATGTTGGCGCTCTCCATGAGCTGGCAGATAGGGGTGCAGTTCTCGCCCACCATT
AGAGACTATGTGATGCGTCTGGTCGTCCGGAGGCAGATGCGGGCTCTGCGGCGGAAGACAAAAACAGGAGACGAG
GGCATCGACTGGGTCAGCGTTGACGAGGCCATCGCAAGAGAGCTCGTCTCTCAAAGGGCCTTTGTCAAACAGCGG
CTGAATGATACGCTTCCAGCCTGGTACGAGGTGCCCATCAAAGTGCGGACAGAGCGCTATATACACTTTACCAGC
AGCATGGAGCTCGGCCGCTCGGCCGATCAGCTCATCGGCCTGCTAAAGAACGACCTGGAGGGCATCGTCGAGACG
CTCGAGGACTACAAGTCGACAGCCCGAGACGGCCAGGAGGTCCTGACGACCACCGACCGAGGGCACGTCGAGCCT
CGAGCGCCAAAGTTCCTCCTCGTATTGTTTGACGTCGTCATCTTTGCCTACGTCTGCTACTCTTTCTGGACGCAG
CCCTTTACCTTCAACACCGTCGTAGCCTACAGCACCGTCGTCGTCATCAAGCAGACGATCCTGGCACTCAAGCGG
TACCAGACGGTCAAGGGCGCGCGTCGACTCTTCACAAACATGGTCTCTATCAACATCCTCGGAATGCTGCTAGTG
TCGACGCCCGTGACGGTGGATAGAAAGGTGCTGGCCAAGGACGGGAACATGGTGGCTTTGACGCTGGCCATGGTC
TTTGCTACCTTGTTTCTGGCTGAGCCTGTTGCTCCGGCTTTGCTGACGGTGACGGAGAGGGGTGTTGCTGCGTCG
TCGAGAGTGGTGGGTAGGATTCGAGGGCGAGGTAGGGAGAGACAGAAAGGAGGAGATGGCGTTGGATAGGGGAGG
GTTGTCTGAGAATGTTGCTGGATGGGGATTCCTGTGCCGTTGGGTACGATGCTGAAGATGTGGCAGATTGGATTC
ACTCAGCGGACAGAGGAAGAGTCGGTCATGACTTATGACTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail