Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03755
Gene name
Locationscaffold_03:3737779..3741338
Strand-
Gene length (bp)3559
Transcript length (bp)3498
Coding sequence length (bp)3498
Protein length (aa) 1166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03770 IPK Inositol polyphosphate kinase 3.2E-55 891 1109

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0032958 inositol phosphate biosynthetic process Yes
GO:0046165 alcohol biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0006066 alcohol metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003824 catalytic activity No
GO:0044283 small molecule biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0019751 polyol metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043647 inositol phosphate metabolic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0046173 polyol biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.699 0.5943 0.1438 0.1911 0.1056 0.0068 0.1117 0.0692 0.0779 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5236
Ophiocordyceps australis map64 (Brazil) OphauB2|2901
Ophiocordyceps camponoti-floridani Ophcf2|03755 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3298
Ophiocordyceps kimflemingae Ophio5|376
Ophiocordyceps subramaniannii Hirsu2|9927

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03755
MSGSPPESENAAPPALLRPAGRRAAADLDHYHHHHDDGHHGSEAEPQLSSPSTESRVSSSSSTSPASTTPTSRHR
DSLSADDSKPVSATRQPGPSLLSQALSSARGINALPSSSSQQDSASMLLPIRPLPDKQLSSPRPSRDALATDGQA
HAPLISGSSQPVAVAAPAPVSASGSWSYNRSAWTYKRDVLPVHRNSSSVPDAEFSSSTDLHHAPSSHTPDSTQSS
SMEHKREPDVPERDSQRTPRPSSHALPRTPEKKEKAWSIGSGGGDDADGLVEQSVAEAMAGVEPNARSRKASYSL
RFFKEVLPPDEKGRRKDTRTGSHRDKLSPAIEEGPSFFDDVSPCAASLPLSTPVSEVPPTLVTTNQARAASPPRS
RPSGPVAEQVLNGSADAAPALDASDADADAEDSGEEKISSAVFLPHQEMPEARPRTGEGPGSVCTTQPRSLSHSK
AHPWLVKADEPEPEPELDDRDEPNLSSPRLRPRETLVLSRGERPVERPDDCAVEDDGEAKSQVLCRASRENQFFA
RKPLEAIELIPYKHQVGGHTTLWRFSRRAVCKQLNNRENEFYETIERYHRDLLPFLPRYIGVLNVTFQKLSRRKS
AAKKDDSAAVDRKKALDGVNRDAMANGRGNGGPARPMVAVRVVSQSLASASLQIPTVTFDDNKHILPRNLLQPTA
SPELFRRRSISINSVDPSSLTRPSLEERPNSWGATTINKRLRNEVFNDAFLKAPVEVQKHRRPHQRSIPRPTMQR
PIRPSHSDPNLGPLEKDETDGQEEGSFPSPPVDERQSPAQGLPESVARLGLDDITGSSAPEPETLKTELVAMKKK
RRFSAGGLRRKPEDVRESRGSLKYFEEADDVDDSKRGAEVRKIPRPINPKEAKKEARTRPDRVEYFLLLEDLTAG
MKRPCMMDLKMGTRQYGVDASPKKQRSQQDKCRTTTSSELGVRICGLQVWNARTQSYDFQDKYFGRQVKAGPEFQ
AALQKFLYNGVDLDSVLRHIPLVLQKLARLERIIRGLRGYRFYAASLLMFYDGDASDDGYETLYDSTTDGATDTE
ETKSRGKRKNRRDIDFKMADFANSLTPLDKMDDKPCPPQHPDHADGGFLKGLASLRRYFLRIQRDVRAELGLCGP
RARFVADVVDGTVDAADDDEDVEGRVRDDDDDDQEGFESV*
Coding >Ophcf2|03755
ATGTCTGGTTCGCCCCCTGAGTCCGAAAATGCCGCACCTCCTGCACTGCTAAGGCCTGCGGGCCGACGTGCCGCT
GCCGATCTCGACCACTACCACCATCACCATGACGATGGTCATCATGGCTCCGAGGCCGAGCCGCAGCTCTCCTCT
CCTTCCACCGAGTCTCGAGTCTCGTCTTCCTCCTCGACTTCACCCGCCTCCACCACTCCCACTTCCCGCCACCGG
GACTCGCTCTCCGCCGACGACTCAAAGCCCGTCTCCGCCACCAGACAACCTGGTCCGTCTTTGTTGTCCCAGGCC
CTGTCTTCCGCTCGGGGTATCAACGCCTTACCGTCGAGCTCCTCGCAGCAAGATTCAGCCTCCATGTTGCTCCCG
ATCCGACCCTTGCCTGACAAACAACTCTCCTCGCCCCGTCCATCGCGAGATGCCCTCGCCACCGACGGACAGGCA
CATGCGCCTCTGATCAGTGGCTCTTCGCAGCCGGTCGCTGTGGCTGCTCCGGCCCCCGTGTCCGCCTCCGGTTCC
TGGTCGTACAACCGCTCCGCTTGGACCTACAAGCGGGACGTGCTTCCCGTACACCGCAACTCGTCTTCAGTACCG
GATGCCGAATTCTCATCGTCGACGGACCTCCATCACGCCCCGTCGTCGCACACTCCGGACTCGACCCAGTCGTCT
TCCATGGAGCACAAGCGAGAACCAGATGTCCCAGAGCGTGATTCTCAGCGTACGCCACGCCCGTCGTCACACGCG
TTGCCTCGGACGCCCGAAAAGAAGGAAAAGGCTTGGTCGATCGGCTCGGGAGGCGGTGACGACGCCGATGGGCTT
GTCGAGCAATCGGTGGCCGAAGCCATGGCCGGTGTCGAGCCAAACGCGCGCAGCCGCAAGGCCAGCTACAGCCTG
CGCTTCTTCAAGGAAGTTCTGCCGCCAGACGAAAAGGGCCGCAGGAAGGATACGCGGACGGGAAGCCATCGCGAC
AAGCTGTCGCCGGCCATCGAGGAGGGCCCTTCGTTTTTCGACGACGTTTCGCCATGTGCTGCGTCTCTCCCCCTG
TCGACGCCCGTGAGCGAGGTGCCGCCGACGCTGGTGACGACGAACCAGGCCCGTGCCGCCTCGCCGCCCCGGTCT
CGTCCCTCGGGTCCCGTCGCCGAGCAGGTGCTGAATGGTTCGGCCGACGCGGCTCCGGCCCTCGACGCATCCGAC
GCCGACGCCGACGCCGAAGACTCGGGCGAGGAAAAGATATCGTCGGCCGTCTTCCTCCCCCACCAAGAAATGCCC
GAGGCCCGTCCGCGTACGGGCGAAGGCCCGGGCTCTGTCTGTACCACTCAGCCTAGGTCTCTTTCGCACAGTAAG
GCTCATCCCTGGCTCGTCAAGGCCGACGAGCCCGAGCCCGAGCCGGAATTGGATGACAGGGACGAGCCGAACCTG
AGCTCTCCCCGCTTGCGTCCCCGTGAGACCCTCGTGCTGTCCAGGGGCGAACGGCCAGTCGAACGGCCCGATGAC
TGTGCTGTCGAGGACGACGGCGAGGCCAAGAGCCAAGTGCTGTGCCGAGCGTCCCGCGAGAACCAGTTCTTTGCC
CGGAAACCCCTCGAAGCCATCGAGCTCATCCCATACAAGCACCAAGTCGGCGGCCACACCACGCTGTGGCGCTTC
TCCCGCCGCGCCGTCTGTAAGCAACTCAATAATAGGGAAAACGAGTTTTACGAGACCATCGAGAGATATCACCGT
GACCTGCTACCCTTTCTTCCCCGCTACATTGGCGTTCTGAACGTGACCTTTCAGAAGCTGTCCCGCCGTAAGAGC
GCCGCTAAGAAGGACGACTCGGCCGCCGTCGACCGCAAGAAGGCCCTGGACGGGGTCAACAGGGACGCCATGGCT
AATGGCCGGGGAAATGGAGGTCCTGCCAGGCCCATGGTGGCTGTCAGAGTCGTGAGCCAGTCCCTGGCCAGCGCC
AGCCTGCAGATTCCCACCGTCACCTTTGACGACAACAAGCACATCCTGCCGCGGAACCTCCTCCAGCCGACGGCG
TCTCCGGAGCTCTTCCGCCGTCGGAGCATCTCCATCAACTCGGTCGACCCTTCGTCACTCACCCGGCCGTCGCTC
GAGGAGCGGCCCAACAGCTGGGGGGCGACGACGATCAACAAGCGTCTCCGCAACGAGGTCTTCAACGACGCCTTC
CTCAAGGCTCCGGTCGAGGTGCAGAAGCACCGTCGGCCACATCAGCGGTCGATCCCCCGACCGACGATGCAGCGG
CCCATCCGGCCCTCCCACTCCGATCCGAACCTGGGGCCTCTGGAAAAGGACGAGACGGACGGCCAAGAGGAGGGC
TCGTTCCCGTCGCCGCCGGTGGACGAGAGACAGAGTCCGGCCCAGGGCCTGCCGGAGTCTGTAGCGCGGCTCGGC
CTCGACGACATCACCGGCTCTAGTGCTCCGGAGCCGGAGACGCTGAAGACGGAGCTCGTGGCCATGAAGAAGAAG
CGACGCTTCTCGGCCGGTGGGCTCCGGCGCAAGCCAGAAGACGTACGCGAGTCTCGTGGGAGCCTCAAGTACTTT
GAGGAAGCCGATGATGTCGACGACTCGAAACGGGGAGCCGAGGTGCGCAAGATCCCGCGGCCCATCAACCCCAAG
GAGGCCAAGAAGGAGGCTCGCACGCGGCCGGACCGGGTCGAGTACTTTCTGCTGCTGGAGGATCTGACGGCCGGC
ATGAAGCGTCCGTGCATGATGGATCTCAAGATGGGCACGCGACAGTACGGCGTCGACGCCTCTCCCAAGAAGCAG
AGGTCACAGCAGGACAAGTGCCGGACCACGACGTCGTCGGAGCTGGGCGTCCGCATCTGTGGGCTGCAAGTGTGG
AACGCCAGGACGCAGAGCTACGACTTCCAGGACAAGTACTTTGGCAGACAGGTCAAGGCCGGCCCCGAGTTCCAG
GCGGCGCTGCAGAAGTTTCTGTACAACGGCGTGGACCTGGACAGCGTGCTCCGGCACATCCCGCTGGTGTTGCAG
AAGCTGGCCCGGCTGGAGCGCATCATTCGTGGCCTCCGCGGCTACCGCTTCTACGCGGCCAGCCTGCTCATGTTC
TACGACGGCGACGCGTCTGACGATGGCTACGAGACGCTTTACGACTCGACGACGGACGGCGCGACGGACACGGAG
GAGACCAAGTCTCGCGGGAAGCGCAAGAACCGACGAGACATCGACTTCAAGATGGCAGACTTTGCCAACAGCCTG
ACGCCTCTGGACAAGATGGACGACAAGCCGTGTCCGCCCCAGCACCCGGACCATGCCGACGGGGGTTTTCTCAAG
GGGCTCGCCAGTCTGAGGCGCTACTTTTTGCGTATCCAGCGCGACGTCCGTGCCGAGCTGGGCCTCTGCGGGCCT
AGAGCTAGGTTCGTCGCCGATGTGGTCGATGGGACTGTCGATGCGGCCGACGACGATGAGGACGTTGAGGGACGA
GTCCGTGATGATGATGACGACGACCAAGAAGGCTTCGAAAGCGTGTAG
Transcript >Ophcf2|03755
ATGTCTGGTTCGCCCCCTGAGTCCGAAAATGCCGCACCTCCTGCACTGCTAAGGCCTGCGGGCCGACGTGCCGCT
GCCGATCTCGACCACTACCACCATCACCATGACGATGGTCATCATGGCTCCGAGGCCGAGCCGCAGCTCTCCTCT
CCTTCCACCGAGTCTCGAGTCTCGTCTTCCTCCTCGACTTCACCCGCCTCCACCACTCCCACTTCCCGCCACCGG
GACTCGCTCTCCGCCGACGACTCAAAGCCCGTCTCCGCCACCAGACAACCTGGTCCGTCTTTGTTGTCCCAGGCC
CTGTCTTCCGCTCGGGGTATCAACGCCTTACCGTCGAGCTCCTCGCAGCAAGATTCAGCCTCCATGTTGCTCCCG
ATCCGACCCTTGCCTGACAAACAACTCTCCTCGCCCCGTCCATCGCGAGATGCCCTCGCCACCGACGGACAGGCA
CATGCGCCTCTGATCAGTGGCTCTTCGCAGCCGGTCGCTGTGGCTGCTCCGGCCCCCGTGTCCGCCTCCGGTTCC
TGGTCGTACAACCGCTCCGCTTGGACCTACAAGCGGGACGTGCTTCCCGTACACCGCAACTCGTCTTCAGTACCG
GATGCCGAATTCTCATCGTCGACGGACCTCCATCACGCCCCGTCGTCGCACACTCCGGACTCGACCCAGTCGTCT
TCCATGGAGCACAAGCGAGAACCAGATGTCCCAGAGCGTGATTCTCAGCGTACGCCACGCCCGTCGTCACACGCG
TTGCCTCGGACGCCCGAAAAGAAGGAAAAGGCTTGGTCGATCGGCTCGGGAGGCGGTGACGACGCCGATGGGCTT
GTCGAGCAATCGGTGGCCGAAGCCATGGCCGGTGTCGAGCCAAACGCGCGCAGCCGCAAGGCCAGCTACAGCCTG
CGCTTCTTCAAGGAAGTTCTGCCGCCAGACGAAAAGGGCCGCAGGAAGGATACGCGGACGGGAAGCCATCGCGAC
AAGCTGTCGCCGGCCATCGAGGAGGGCCCTTCGTTTTTCGACGACGTTTCGCCATGTGCTGCGTCTCTCCCCCTG
TCGACGCCCGTGAGCGAGGTGCCGCCGACGCTGGTGACGACGAACCAGGCCCGTGCCGCCTCGCCGCCCCGGTCT
CGTCCCTCGGGTCCCGTCGCCGAGCAGGTGCTGAATGGTTCGGCCGACGCGGCTCCGGCCCTCGACGCATCCGAC
GCCGACGCCGACGCCGAAGACTCGGGCGAGGAAAAGATATCGTCGGCCGTCTTCCTCCCCCACCAAGAAATGCCC
GAGGCCCGTCCGCGTACGGGCGAAGGCCCGGGCTCTGTCTGTACCACTCAGCCTAGGTCTCTTTCGCACAGTAAG
GCTCATCCCTGGCTCGTCAAGGCCGACGAGCCCGAGCCCGAGCCGGAATTGGATGACAGGGACGAGCCGAACCTG
AGCTCTCCCCGCTTGCGTCCCCGTGAGACCCTCGTGCTGTCCAGGGGCGAACGGCCAGTCGAACGGCCCGATGAC
TGTGCTGTCGAGGACGACGGCGAGGCCAAGAGCCAAGTGCTGTGCCGAGCGTCCCGCGAGAACCAGTTCTTTGCC
CGGAAACCCCTCGAAGCCATCGAGCTCATCCCATACAAGCACCAAGTCGGCGGCCACACCACGCTGTGGCGCTTC
TCCCGCCGCGCCGTCTGTAAGCAACTCAATAATAGGGAAAACGAGTTTTACGAGACCATCGAGAGATATCACCGT
GACCTGCTACCCTTTCTTCCCCGCTACATTGGCGTTCTGAACGTGACCTTTCAGAAGCTGTCCCGCCGTAAGAGC
GCCGCTAAGAAGGACGACTCGGCCGCCGTCGACCGCAAGAAGGCCCTGGACGGGGTCAACAGGGACGCCATGGCT
AATGGCCGGGGAAATGGAGGTCCTGCCAGGCCCATGGTGGCTGTCAGAGTCGTGAGCCAGTCCCTGGCCAGCGCC
AGCCTGCAGATTCCCACCGTCACCTTTGACGACAACAAGCACATCCTGCCGCGGAACCTCCTCCAGCCGACGGCG
TCTCCGGAGCTCTTCCGCCGTCGGAGCATCTCCATCAACTCGGTCGACCCTTCGTCACTCACCCGGCCGTCGCTC
GAGGAGCGGCCCAACAGCTGGGGGGCGACGACGATCAACAAGCGTCTCCGCAACGAGGTCTTCAACGACGCCTTC
CTCAAGGCTCCGGTCGAGGTGCAGAAGCACCGTCGGCCACATCAGCGGTCGATCCCCCGACCGACGATGCAGCGG
CCCATCCGGCCCTCCCACTCCGATCCGAACCTGGGGCCTCTGGAAAAGGACGAGACGGACGGCCAAGAGGAGGGC
TCGTTCCCGTCGCCGCCGGTGGACGAGAGACAGAGTCCGGCCCAGGGCCTGCCGGAGTCTGTAGCGCGGCTCGGC
CTCGACGACATCACCGGCTCTAGTGCTCCGGAGCCGGAGACGCTGAAGACGGAGCTCGTGGCCATGAAGAAGAAG
CGACGCTTCTCGGCCGGTGGGCTCCGGCGCAAGCCAGAAGACGTACGCGAGTCTCGTGGGAGCCTCAAGTACTTT
GAGGAAGCCGATGATGTCGACGACTCGAAACGGGGAGCCGAGGTGCGCAAGATCCCGCGGCCCATCAACCCCAAG
GAGGCCAAGAAGGAGGCTCGCACGCGGCCGGACCGGGTCGAGTACTTTCTGCTGCTGGAGGATCTGACGGCCGGC
ATGAAGCGTCCGTGCATGATGGATCTCAAGATGGGCACGCGACAGTACGGCGTCGACGCCTCTCCCAAGAAGCAG
AGGTCACAGCAGGACAAGTGCCGGACCACGACGTCGTCGGAGCTGGGCGTCCGCATCTGTGGGCTGCAAGTGTGG
AACGCCAGGACGCAGAGCTACGACTTCCAGGACAAGTACTTTGGCAGACAGGTCAAGGCCGGCCCCGAGTTCCAG
GCGGCGCTGCAGAAGTTTCTGTACAACGGCGTGGACCTGGACAGCGTGCTCCGGCACATCCCGCTGGTGTTGCAG
AAGCTGGCCCGGCTGGAGCGCATCATTCGTGGCCTCCGCGGCTACCGCTTCTACGCGGCCAGCCTGCTCATGTTC
TACGACGGCGACGCGTCTGACGATGGCTACGAGACGCTTTACGACTCGACGACGGACGGCGCGACGGACACGGAG
GAGACCAAGTCTCGCGGGAAGCGCAAGAACCGACGAGACATCGACTTCAAGATGGCAGACTTTGCCAACAGCCTG
ACGCCTCTGGACAAGATGGACGACAAGCCGTGTCCGCCCCAGCACCCGGACCATGCCGACGGGGGTTTTCTCAAG
GGGCTCGCCAGTCTGAGGCGCTACTTTTTGCGTATCCAGCGCGACGTCCGTGCCGAGCTGGGCCTCTGCGGGCCT
AGAGCTAGGTTCGTCGCCGATGTGGTCGATGGGACTGTCGATGCGGCCGACGACGATGAGGACGTTGAGGGACGA
GTCCGTGATGATGATGACGACGACCAAGAAGGCTTCGAAAGCGTGTAG
Gene >Ophcf2|03755
ATGTCTGGTTCGCCCCCTGAGTCCGAAAATGCCGCACCTCCTGCACTGCTAAGGCCTGCGGGCCGACGTGCCGCT
GCCGATCTCGACCACTACCACCATCACCATGACGATGGTCATCATGGCTCCGAGGCCGAGCCGCAGCTCTCCTCT
CCTTCCACCGAGTCTCGAGTCTCGTCTTCCTCCTCGACTTCACCCGCCTCCACCACTCCCACTTCCCGCCACCGG
GACTCGCTCTCCGCCGACGACTCAAAGCCCGTCTCCGCCACCAGACAACCTGGTCCGTCTTTGTTGTCCCAGGCC
CTGTCTTCCGCTCGGGGTATCAACGCCTTACCGTCGAGCTCCTCGCAGCAAGATTCAGCCTCCATGTTGCTCCCG
ATCCGACCCTTGCCTGACAAACAACTCTCCTCGCCCCGTCCATCGCGAGATGCCCTCGCCACCGACGGACAGGCA
CATGCGCCTCTGATCAGTGGCTCTTCGCAGCCGGTCGCTGTGGCTGCTCCGGCCCCCGTGTCCGCCTCCGGTTCC
TGGTCGTACAACCGCTCCGCTTGGACCTACAAGCGGGACGTGCTTCCCGTACACCGCAACTCGTCTTCAGTACCG
GATGCCGAATTCTCATCGTCGACGGACCTCCATCACGCCCCGTCGTCGCACACTCCGGACTCGACCCAGTCGTCT
TCCATGGAGCACAAGCGAGAACCAGATGTCCCAGAGCGTGATTCTCAGCGTACGCCACGCCCGTCGTCACACGCG
TTGCCTCGGACGCCCGAAAAGAAGGAAAAGGCTTGGTCGATCGGCTCGGGAGGCGGTGACGACGCCGATGGGCTT
GTCGAGCAATCGGTGGCCGAAGCCATGGCCGGTGTCGAGCCAAACGCGCGCAGCCGCAAGGCCAGCTACAGCCTG
CGCTTCTTCAAGGAAGTTCTGCCGCCAGACGAAAAGGGCCGCAGGAAGGATACGCGGACGGGAAGCCATCGCGAC
AAGCTGTCGCCGGCCATCGAGGAGGGCCCTTCGTTTTTCGACGACGTTTCGCCATGTGCTGCGTCTCTCCCCCTG
TCGACGCCCGTGAGCGAGGTGCCGCCGACGCTGGTGACGACGAACCAGGCCCGTGCCGCCTCGCCGCCCCGGTCT
CGTCCCTCGGGTCCCGTCGCCGAGCAGGTGCTGAATGGTTCGGCCGACGCGGCTCCGGCCCTCGACGCATCCGAC
GCCGACGCCGACGCCGAAGACTCGGGCGAGGAAAAGATATCGTCGGCCGTCTTCCTCCCCCACCAAGAAATGCCC
GAGGCCCGTCCGCGTACGGGCGAAGGCCCGGGCTCTGTCTGTACCACTCAGCCTAGGTCTCTTTCGCACAGTAAG
GCTCATCCCTGGCTCGTCAAGGCCGACGAGCCCGAGCCCGAGCCGGAATTGGATGACAGGGACGAGCCGAACCTG
AGCTCTCCCCGCTTGCGTCCCCGTGAGACCCTCGTGCTGTCCAGGGGCGAACGGCCAGTCGAACGGCCCGATGAC
TGTGCTGTCGAGGACGACGGCGAGGCCAAGAGCCAAGTGCTGTGCCGAGCGTCCCGCGAGAACCAGTTCTTTGCC
CGGAAACCCCTCGAAGCCATCGAGCTCATCCCATACAAGCACCAAGTCGGCGGCCACACCACGCTGTGGCGCTTC
TCCCGCCGCGCCGTCTGTAAGCAACTCAATAATAGGGAAAACGAGTTTTACGAGACCATCGAGAGATATCACCGT
GACCTGCTACCCTTTCTTCCCCGGTACGTCTCCTTGGGTCTTGTCCAGTCGTGCCGAAGATAAGGCTAACCTCGT
CGTCGTCAGCTACATTGGCGTTCTGAACGTGACCTTTCAGAAGCTGTCCCGCCGTAAGAGCGCCGCTAAGAAGGA
CGACTCGGCCGCCGTCGACCGCAAGAAGGCCCTGGACGGGGTCAACAGGGACGCCATGGCTAATGGCCGGGGAAA
TGGAGGTCCTGCCAGGCCCATGGTGGCTGTCAGAGTCGTGAGCCAGTCCCTGGCCAGCGCCAGCCTGCAGATTCC
CACCGTCACCTTTGACGACAACAAGCACATCCTGCCGCGGAACCTCCTCCAGCCGACGGCGTCTCCGGAGCTCTT
CCGCCGTCGGAGCATCTCCATCAACTCGGTCGACCCTTCGTCACTCACCCGGCCGTCGCTCGAGGAGCGGCCCAA
CAGCTGGGGGGCGACGACGATCAACAAGCGTCTCCGCAACGAGGTCTTCAACGACGCCTTCCTCAAGGCTCCGGT
CGAGGTGCAGAAGCACCGTCGGCCACATCAGCGGTCGATCCCCCGACCGACGATGCAGCGGCCCATCCGGCCCTC
CCACTCCGATCCGAACCTGGGGCCTCTGGAAAAGGACGAGACGGACGGCCAAGAGGAGGGCTCGTTCCCGTCGCC
GCCGGTGGACGAGAGACAGAGTCCGGCCCAGGGCCTGCCGGAGTCTGTAGCGCGGCTCGGCCTCGACGACATCAC
CGGCTCTAGTGCTCCGGAGCCGGAGACGCTGAAGACGGAGCTCGTGGCCATGAAGAAGAAGCGACGCTTCTCGGC
CGGTGGGCTCCGGCGCAAGCCAGAAGACGTACGCGAGTCTCGTGGGAGCCTCAAGTACTTTGAGGAAGCCGATGA
TGTCGACGACTCGAAACGGGGAGCCGAGGTGCGCAAGATCCCGCGGCCCATCAACCCCAAGGAGGCCAAGAAGGA
GGCTCGCACGCGGCCGGACCGGGTCGAGTACTTTCTGCTGCTGGAGGATCTGACGGCCGGCATGAAGCGTCCGTG
CATGATGGATCTCAAGATGGGCACGCGACAGTACGGCGTCGACGCCTCTCCCAAGAAGCAGAGGTCACAGCAGGA
CAAGTGCCGGACCACGACGTCGTCGGAGCTGGGCGTCCGCATCTGTGGGCTGCAAGTGTGGAACGCCAGGACGCA
GAGCTACGACTTCCAGGACAAGTACTTTGGCAGACAGGTCAAGGCCGGCCCCGAGTTCCAGGCGGCGCTGCAGAA
GTTTCTGTACAACGGCGTGGACCTGGACAGCGTGCTCCGGCACATCCCGCTGGTGTTGCAGAAGCTGGCCCGGCT
GGAGCGCATCATTCGTGGCCTCCGCGGCTACCGCTTCTACGCGGCCAGCCTGCTCATGTTCTACGACGGCGACGC
GTCTGACGATGGCTACGAGACGCTTTACGACTCGACGACGGACGGCGCGACGGACACGGAGGAGACCAAGTCTCG
CGGGAAGCGCAAGAACCGACGAGACATCGACTTCAAGATGGCAGACTTTGCCAACAGCCTGACGCCTCTGGACAA
GATGGACGACAAGCCGTGTCCGCCCCAGCACCCGGACCATGCCGACGGGGGTTTTCTCAAGGGGCTCGCCAGTCT
GAGGCGCTACTTTTTGCGTATCCAGCGCGACGTCCGTGCCGAGCTGGGCCTCTGCGGGCCTAGAGCTAGGTTCGT
CGCCGATGTGGTCGATGGGACTGTCGATGCGGCCGACGACGATGAGGACGTTGAGGGACGAGTCCGTGATGATGA
TGACGACGACCAAGAAGGCTTCGAAAGCGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail