Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03753
Gene name
Locationscaffold_03:3733913..3734801
Strand-
Gene length (bp)888
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08660 Alg14 Oligosaccharide biosynthesis protein Alg14 like 2.8E-39 77 261

GO

GO Term Description Terminal node
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0071704 organic substance metabolic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 153 175 22
3 190 212 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 56.46 29.55 83.36
Alive In ants, during behavior modification 79.88 43.12 116.65
Dead In ants, recently dead 57.35 30.09 84.61

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.089776 no
Alive Dead 0.054675 no
Dead Fungus 0.953725 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03753
MRRSSGPAAASLAAGLTILRLSPHSIIVKTSFALAVALAIFATTRHVQLLRHRRVTRWPSRNAPVVPLAERPDYH
LFVLGSGGHTKEMLMMMDDGFCDMARLHRRYLLSSGDRVSRHQLEDYEARLTSLCCGAGTEAGTYDVRTVLRARR
VHQSLLTTPFTALASIAAIVSVLLSPPVNVTGRAVKFPTMVFSNGPGTGFCVALAVHLLKVFCVVPDDVMRFVYV
ESWARISSLSLTARLLRRLGVADALYVQHAEVAAKYGLPCAGEMVLNARHLDD*
Coding >Ophcf2|03753
ATGCGCCGCTCCTCGGGGCCCGCAGCAGCCTCACTCGCAGCGGGCCTCACCATCTTGCGCCTAAGCCCTCACAGC
ATCATCGTGAAAACGAGCTTCGCCCTAGCCGTCGCCCTGGCCATCTTCGCCACGACGAGACACGTTCAGCTTCTT
CGTCACCGCCGCGTAACCCGCTGGCCCTCGAGAAACGCACCGGTCGTGCCCCTCGCTGAACGGCCAGACTATCAC
CTCTTCGTCCTCGGCTCTGGCGGACATACGAAGGAGATGCTCATGATGATGGACGATGGCTTCTGTGATATGGCG
CGTCTTCATCGTCGGTATCTGCTTTCTAGCGGCGATCGTGTCTCGCGTCATCAACTTGAAGACTACGAGGCTCGG
CTTACGAGCCTGTGTTGCGGGGCGGGAACGGAGGCTGGCACGTACGATGTTCGAACCGTTCTGCGCGCCCGTCGT
GTACATCAGTCTCTTCTCACGACGCCATTTACGGCTCTCGCTTCCATCGCGGCCATCGTGTCCGTTCTGCTATCG
CCACCGGTCAACGTGACGGGTCGAGCGGTGAAGTTCCCGACCATGGTGTTTTCGAATGGTCCTGGAACGGGTTTC
TGCGTCGCGCTGGCTGTACATCTTCTCAAGGTGTTCTGCGTCGTGCCTGATGATGTTATGCGCTTCGTCTACGTT
GAGTCGTGGGCGCGGATATCGTCGCTCAGCTTGACGGCTCGTCTGCTGCGGCGGTTGGGCGTTGCTGATGCATTG
TACGTTCAGCACGCTGAGGTGGCTGCCAAGTACGGCCTGCCGTGTGCCGGGGAGATGGTTCTCAACGCGAGGCAT
CTGGACGACTAG
Transcript >Ophcf2|03753
ATGCGCCGCTCCTCGGGGCCCGCAGCAGCCTCACTCGCAGCGGGCCTCACCATCTTGCGCCTAAGCCCTCACAGC
ATCATCGTGAAAACGAGCTTCGCCCTAGCCGTCGCCCTGGCCATCTTCGCCACGACGAGACACGTTCAGCTTCTT
CGTCACCGCCGCGTAACCCGCTGGCCCTCGAGAAACGCACCGGTCGTGCCCCTCGCTGAACGGCCAGACTATCAC
CTCTTCGTCCTCGGCTCTGGCGGACATACGAAGGAGATGCTCATGATGATGGACGATGGCTTCTGTGATATGGCG
CGTCTTCATCGTCGGTATCTGCTTTCTAGCGGCGATCGTGTCTCGCGTCATCAACTTGAAGACTACGAGGCTCGG
CTTACGAGCCTGTGTTGCGGGGCGGGAACGGAGGCTGGCACGTACGATGTTCGAACCGTTCTGCGCGCCCGTCGT
GTACATCAGTCTCTTCTCACGACGCCATTTACGGCTCTCGCTTCCATCGCGGCCATCGTGTCCGTTCTGCTATCG
CCACCGGTCAACGTGACGGGTCGAGCGGTGAAGTTCCCGACCATGGTGTTTTCGAATGGTCCTGGAACGGGTTTC
TGCGTCGCGCTGGCTGTACATCTTCTCAAGGTGTTCTGCGTCGTGCCTGATGATGTTATGCGCTTCGTCTACGTT
GAGTCGTGGGCGCGGATATCGTCGCTCAGCTTGACGGCTCGTCTGCTGCGGCGGTTGGGCGTTGCTGATGCATTG
TACGTTCAGCACGCTGAGGTGGCTGCCAAGTACGGCCTGCCGTGTGCCGGGGAGATGGTTCTCAACGCGAGGCAT
CTGGACGACTAG
Gene >Ophcf2|03753
ATGCGCCGCTCCTCGGGGCCCGCAGCAGCCTCACTCGCAGCGGGCCTCACCATCTTGCGCCTAAGCCCTCACAGC
ATCATCGTGAAAACGAGCTTCGCCCTAGCCGTCGCCCTGGCCATCTTCGCCACGGTTCGTCTCCCCTTCAGTTCC
CATCCTGGCAAAACTGACGAGCGCACCAAGACGAGACACGTTCAGCTTCTTCGTCACCGCCGCGTAACCCGCTGG
CCCTCGAGAAACGCACCGGTCGTGCCCCTCGCTGAACGGCCAGACTATCACCTCTTCGTCCTCGGCTCTGGCGGA
CATACGAAGGAGATGCTCATGATGATGGACGATGGCTTCTGTGATATGGCGCGTCTTCATCGTCGGTATCTGCTT
TCTAGCGGCGATCGTGTCTCGCGTCATCAACTTGAAGACTACGAGGCTCGGCTTACGAGCCTGTGTTGCGGGGCG
GGAACGGAGGCTGGCACGTACGATGTTCGAACCGTTCTGCGCGCCCGTCGTGTACATCAGTCTCTTCTCACGACG
CCATTTACGGCTCTCGCTTCCATCGCGGCCATCGTGTCCGTTCTGCTATCGCCACCGGTCAACGTGACGGGTCGA
GCGGTGAAGTTCCCGACCATGGTGTTTTCGAATGGTCCTGGAACGGGTTTCTGCGTCGCGCTGGCTGTACATCTT
CTCAAGGTGTTCTGCGTCGTGCCTGATGATGTTATGCGCTTCGTCTACGTTGAGTCGTGGGCGCGGATATCGTCG
CTCAGCTTGACGGCTCGTCTGCTGCGGCGGTTGGGCGTTGCTGATGCATTGTACGTTCAGCACGCTGAGGTGGCT
GCCAAGTACGGCCTGCCGTGTGCCGGGGAGATGGTTCTCAACGCGAGGCATCTGGACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail