Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03753
Gene name
Locationscaffold_03:3733913..3734801
Strand-
Gene length (bp)888
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08660 Alg14 Oligosaccharide biosynthesis protein Alg14 like 2.8E-39 77 261

GO

GO Term Description Terminal node
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0071704 organic substance metabolic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 153 175 22
3 190 212 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03753
MRRSSGPAAASLAAGLTILRLSPHSIIVKTSFALAVALAIFATTRHVQLLRHRRVTRWPSRNAPVVPLAERPDYH
LFVLGSGGHTKEMLMMMDDGFCDMARLHRRYLLSSGDRVSRHQLEDYEARLTSLCCGAGTEAGTYDVRTVLRARR
VHQSLLTTPFTALASIAAIVSVLLSPPVNVTGRAVKFPTMVFSNGPGTGFCVALAVHLLKVFCVVPDDVMRFVYV
ESWARISSLSLTARLLRRLGVADALYVQHAEVAAKYGLPCAGEMVLNARHLDD*
Coding >Ophcf2|03753
ATGCGCCGCTCCTCGGGGCCCGCAGCAGCCTCACTCGCAGCGGGCCTCACCATCTTGCGCCTAAGCCCTCACAGC
ATCATCGTGAAAACGAGCTTCGCCCTAGCCGTCGCCCTGGCCATCTTCGCCACGACGAGACACGTTCAGCTTCTT
CGTCACCGCCGCGTAACCCGCTGGCCCTCGAGAAACGCACCGGTCGTGCCCCTCGCTGAACGGCCAGACTATCAC
CTCTTCGTCCTCGGCTCTGGCGGACATACGAAGGAGATGCTCATGATGATGGACGATGGCTTCTGTGATATGGCG
CGTCTTCATCGTCGGTATCTGCTTTCTAGCGGCGATCGTGTCTCGCGTCATCAACTTGAAGACTACGAGGCTCGG
CTTACGAGCCTGTGTTGCGGGGCGGGAACGGAGGCTGGCACGTACGATGTTCGAACCGTTCTGCGCGCCCGTCGT
GTACATCAGTCTCTTCTCACGACGCCATTTACGGCTCTCGCTTCCATCGCGGCCATCGTGTCCGTTCTGCTATCG
CCACCGGTCAACGTGACGGGTCGAGCGGTGAAGTTCCCGACCATGGTGTTTTCGAATGGTCCTGGAACGGGTTTC
TGCGTCGCGCTGGCTGTACATCTTCTCAAGGTGTTCTGCGTCGTGCCTGATGATGTTATGCGCTTCGTCTACGTT
GAGTCGTGGGCGCGGATATCGTCGCTCAGCTTGACGGCTCGTCTGCTGCGGCGGTTGGGCGTTGCTGATGCATTG
TACGTTCAGCACGCTGAGGTGGCTGCCAAGTACGGCCTGCCGTGTGCCGGGGAGATGGTTCTCAACGCGAGGCAT
CTGGACGACTAG
Transcript >Ophcf2|03753
ATGCGCCGCTCCTCGGGGCCCGCAGCAGCCTCACTCGCAGCGGGCCTCACCATCTTGCGCCTAAGCCCTCACAGC
ATCATCGTGAAAACGAGCTTCGCCCTAGCCGTCGCCCTGGCCATCTTCGCCACGACGAGACACGTTCAGCTTCTT
CGTCACCGCCGCGTAACCCGCTGGCCCTCGAGAAACGCACCGGTCGTGCCCCTCGCTGAACGGCCAGACTATCAC
CTCTTCGTCCTCGGCTCTGGCGGACATACGAAGGAGATGCTCATGATGATGGACGATGGCTTCTGTGATATGGCG
CGTCTTCATCGTCGGTATCTGCTTTCTAGCGGCGATCGTGTCTCGCGTCATCAACTTGAAGACTACGAGGCTCGG
CTTACGAGCCTGTGTTGCGGGGCGGGAACGGAGGCTGGCACGTACGATGTTCGAACCGTTCTGCGCGCCCGTCGT
GTACATCAGTCTCTTCTCACGACGCCATTTACGGCTCTCGCTTCCATCGCGGCCATCGTGTCCGTTCTGCTATCG
CCACCGGTCAACGTGACGGGTCGAGCGGTGAAGTTCCCGACCATGGTGTTTTCGAATGGTCCTGGAACGGGTTTC
TGCGTCGCGCTGGCTGTACATCTTCTCAAGGTGTTCTGCGTCGTGCCTGATGATGTTATGCGCTTCGTCTACGTT
GAGTCGTGGGCGCGGATATCGTCGCTCAGCTTGACGGCTCGTCTGCTGCGGCGGTTGGGCGTTGCTGATGCATTG
TACGTTCAGCACGCTGAGGTGGCTGCCAAGTACGGCCTGCCGTGTGCCGGGGAGATGGTTCTCAACGCGAGGCAT
CTGGACGACTAG
Gene >Ophcf2|03753
ATGCGCCGCTCCTCGGGGCCCGCAGCAGCCTCACTCGCAGCGGGCCTCACCATCTTGCGCCTAAGCCCTCACAGC
ATCATCGTGAAAACGAGCTTCGCCCTAGCCGTCGCCCTGGCCATCTTCGCCACGGTTCGTCTCCCCTTCAGTTCC
CATCCTGGCAAAACTGACGAGCGCACCAAGACGAGACACGTTCAGCTTCTTCGTCACCGCCGCGTAACCCGCTGG
CCCTCGAGAAACGCACCGGTCGTGCCCCTCGCTGAACGGCCAGACTATCACCTCTTCGTCCTCGGCTCTGGCGGA
CATACGAAGGAGATGCTCATGATGATGGACGATGGCTTCTGTGATATGGCGCGTCTTCATCGTCGGTATCTGCTT
TCTAGCGGCGATCGTGTCTCGCGTCATCAACTTGAAGACTACGAGGCTCGGCTTACGAGCCTGTGTTGCGGGGCG
GGAACGGAGGCTGGCACGTACGATGTTCGAACCGTTCTGCGCGCCCGTCGTGTACATCAGTCTCTTCTCACGACG
CCATTTACGGCTCTCGCTTCCATCGCGGCCATCGTGTCCGTTCTGCTATCGCCACCGGTCAACGTGACGGGTCGA
GCGGTGAAGTTCCCGACCATGGTGTTTTCGAATGGTCCTGGAACGGGTTTCTGCGTCGCGCTGGCTGTACATCTT
CTCAAGGTGTTCTGCGTCGTGCCTGATGATGTTATGCGCTTCGTCTACGTTGAGTCGTGGGCGCGGATATCGTCG
CTCAGCTTGACGGCTCGTCTGCTGCGGCGGTTGGGCGTTGCTGATGCATTGTACGTTCAGCACGCTGAGGTGGCT
GCCAAGTACGGCCTGCCGTGTGCCGGGGAGATGGTTCTCAACGCGAGGCATCTGGACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail