Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03748
Gene name
Locationscaffold_03:3724963..3725803
Strand+
Gene length (bp)840
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13373 Dsc3_C DSC E3 ubiquitin ligase complex subunit 3, C-terminal domain 7.8E-31 151 273
PF10302 Dsc3_N DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain 9.0E-26 13 111

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 226 245 19
2 255 272 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03748
MTDSPSVASDPLHLTIRFSSSIPDLDLDIASPERTTVLSLKHLLRSRIDSRSRLRLIYQGHILPDPCALSAVLRP
LPPSAQQDDDNNAGASKGKAVAALLRIYVNCSIGDELSEEDLVAEEAAADDPPAYVDPGHNAGSSGRQTRTRPRP
RGFDRFLHAGFTASEISTLRAQFTLIQSSRFLPDSMPSPDSMRSLEDAWIDSNAGPMPTTTAMIEDDGSIASYVD
ILIRGLAIGFFFPLGTFTWLLRGDVWNDKWRVFVAFGVILSVAIGVVKGISEQR*
Coding >Ophcf2|03748
ATGACAGATTCCCCGTCAGTGGCCTCGGACCCCCTCCACTTAACCATCCGCTTCTCCTCGTCCATTCCCGACCTC
GACCTCGACATCGCATCCCCAGAGCGCACCACCGTCCTCTCCCTCAAGCACCTCCTCCGCTCCCGCATCGACTCT
CGCAGCCGTCTGCGCCTCATCTACCAGGGCCACATCCTCCCCGATCCGTGCGCCCTCAGCGCCGTCCTCAGGCCC
CTACCCCCCTCGGCGCAGCAAGACGACGACAATAATGCGGGAGCCAGCAAAGGAAAGGCCGTCGCCGCACTGCTC
CGCATCTACGTGAACTGCTCCATCGGCGATGAGCTTTCGGAAGAGGACCTCGTCGCCGAGGAGGCGGCCGCCGAC
GACCCTCCCGCCTACGTCGATCCTGGCCACAACGCCGGTAGCTCCGGCCGTCAGACCCGGACGCGCCCCCGTCCC
CGAGGCTTCGATCGCTTCCTCCATGCCGGCTTCACGGCGTCGGAGATATCGACTCTACGTGCCCAGTTCACCCTC
ATCCAGTCCAGCCGCTTCCTCCCAGACTCGATGCCCTCTCCCGACTCGATGCGCAGCCTCGAAGATGCCTGGATT
GATTCCAACGCGGGGCCCATGCCGACGACGACGGCCATGATCGAAGATGACGGTAGCATCGCTTCTTACGTCGAC
ATCTTGATTCGTGGCCTGGCTATCGGATTCTTCTTCCCTCTCGGCACTTTCACATGGCTGCTTCGAGGCGACGTT
TGGAACGACAAATGGCGCGTCTTCGTTGCCTTTGGCGTGATACTGAGCGTCGCTATTGGCGTCGTCAAGGGGATA
TCCGAACAGCGCTGA
Transcript >Ophcf2|03748
ATGACAGATTCCCCGTCAGTGGCCTCGGACCCCCTCCACTTAACCATCCGCTTCTCCTCGTCCATTCCCGACCTC
GACCTCGACATCGCATCCCCAGAGCGCACCACCGTCCTCTCCCTCAAGCACCTCCTCCGCTCCCGCATCGACTCT
CGCAGCCGTCTGCGCCTCATCTACCAGGGCCACATCCTCCCCGATCCGTGCGCCCTCAGCGCCGTCCTCAGGCCC
CTACCCCCCTCGGCGCAGCAAGACGACGACAATAATGCGGGAGCCAGCAAAGGAAAGGCCGTCGCCGCACTGCTC
CGCATCTACGTGAACTGCTCCATCGGCGATGAGCTTTCGGAAGAGGACCTCGTCGCCGAGGAGGCGGCCGCCGAC
GACCCTCCCGCCTACGTCGATCCTGGCCACAACGCCGGTAGCTCCGGCCGTCAGACCCGGACGCGCCCCCGTCCC
CGAGGCTTCGATCGCTTCCTCCATGCCGGCTTCACGGCGTCGGAGATATCGACTCTACGTGCCCAGTTCACCCTC
ATCCAGTCCAGCCGCTTCCTCCCAGACTCGATGCCCTCTCCCGACTCGATGCGCAGCCTCGAAGATGCCTGGATT
GATTCCAACGCGGGGCCCATGCCGACGACGACGGCCATGATCGAAGATGACGGTAGCATCGCTTCTTACGTCGAC
ATCTTGATTCGTGGCCTGGCTATCGGATTCTTCTTCCCTCTCGGCACTTTCACATGGCTGCTTCGAGGCGACGTT
TGGAACGACAAATGGCGCGTCTTCGTTGCCTTTGGCGTGATACTGAGCGTCGCTATTGGCGTCGTCAAGGGGATA
TCCGAACAGCGCTGA
Gene >Ophcf2|03748
ATGACAGATTCCCCGTCAGTGGCCTCGGACCCCCTCCACTTAACCATCCGCTTCTCCTCGTCCATTCCCGACCTC
GACCTCGACATCGCATCCCCAGAGCGCACCACCGTCCTCTCCCTCAAGCACCTCCTCCGCTCCCGCATCGACTCT
CGCAGCCGTCTGCGCCTCATCTACCAGGGCCACATCCTCCCCGATCCGTGCGCCCTCAGCGCCGTCCTCAGGCCC
CTACCCCCCTCGGCGCAGCAAGACGACGACAATAATGCGGGAGCCAGCAAAGGAAAGGCCGTCGCCGCACTGCTC
CGCATCTACGTGAACTGCTCCATCGGCGATGAGCTTTCGGAAGAGGACCTCGTCGCCGAGGAGGCGGCCGCCGAC
GACCCTCCCGCCTACGTCGATCCTGGCCACAACGCCGGTAGCTCCGGCCGTCAGACCCGGACGCGCCCCCGTCCC
CGAGGCTTCGATCGCTTCCTCCATGCCGGCTTCACGGCGTCGGAGATATCGACTCTACGTGCCCAGTTCACCCTC
ATCCAGTCCAGCCGCTTCCTCCCAGACTCGATGCCCTCTCCCGACTCGATGCGCAGCCTCGAAGATGCCTGGATT
GATTCCAACGCGGGGCCCATGCCGACGACGACGGCCATGATCGAAGATGACGGTAGCATCGCTTCTTACGTCGAC
ATCTTGATTCGTGGCCTGGCTATCGGATTCTTCTTCCCTCTCGGCACTTTCACATGGCTGCTTCGAGGCGACGTT
TGGAACGACAAATGGCGCGTCTTCGTTGCCTTTGGCGTGATACTGAGCGTCGCTATTGGCGTCGTCAAGGGGATA
TCCGAACAGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail