Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03747
Gene name
Locationscaffold_03:3722377..3724592
Strand-
Gene length (bp)2215
Transcript length (bp)2091
Coding sequence length (bp)2091
Protein length (aa) 697

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09779 Ima1_N Ima1 N-terminal domain 8.6E-34 7 132

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 267 289 22
2 296 315 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03747
MARFGPLSCFYCGRRSGLRNDGKTREFVCRYCEATNYLDEKGEITDPPVATDCDAAPTTMQFATPKRPAPTDSIF
CASCLKNQYLLTTSLAQYLPDDPSDPDYAPLERNYHRYRRGLEKRYPQVCDSCADRVEARLRQAGYTAKTDHLRH
MMELSRGKRRQKASSRGFLDWVSCLGAAVWRAGFAMQLVGHLVAVAPLLKDGGDGLRDPAEGLSFMVRLGGLADG
LPLPEWFARWGFVAAAAAVWWNPYFVQLVRGFTRHLSGFSQWYSFQGLVVVSRFICWGLVGGGIEGQTRQASISI
HVAMAAVTMLMYLVMGRSIRVDTRPLFGVGVSPGPKEPASSPLRKREEATKTLSDMLIDALESTPQKQGKRPVTD
VSPSSQTGFSPRSPPRQRRAYEDHHDIDTASRLPQQVQYAQEMDWSPVTPRHRALAPAQQSPSRGGMDTVEKSPF
WYKVPAAPVTPARQLRNPPRAPTAKPTATEAHHSYNFSPAATRQSGSGVRSTGVEFRQQQFFAPERDDANSLADL
LGQSFSLSQEGDEDDDDDDDDDDDDDDDDDDVGEEKGPEMKKKGITAKGTSRKTTRARQRDSAWYRRLERVAAIM
LPILWTLTLSSTLPFRTECQTAMIALSGFLSLPTAGADSHDKLRAAWATAELAASCWVLSALWTDEGRRAWWCGA
GVLASGALRRLGMERWMHVRG*
Coding >Ophcf2|03747
ATGGCGCGCTTCGGACCTCTGAGCTGCTTCTACTGCGGGAGGCGATCTGGACTGCGGAACGATGGGAAGACGCGA
GAGTTCGTGTGCCGGTATTGCGAGGCGACCAACTACCTGGACGAGAAGGGCGAAATCACAGACCCTCCTGTTGCG
ACAGACTGTGATGCCGCGCCGACGACGATGCAGTTTGCTACCCCGAAGCGACCGGCCCCGACGGACAGCATCTTC
TGCGCGTCCTGCCTGAAGAACCAGTACCTTCTGACGACGTCGCTGGCTCAATACCTCCCCGACGACCCCTCCGAT
CCGGACTACGCGCCGCTGGAGCGCAACTATCACCGTTACCGTCGCGGTCTGGAGAAGCGATACCCGCAGGTATGC
GACTCTTGCGCCGACCGGGTCGAAGCCCGGCTCCGACAGGCGGGGTATACGGCCAAGACGGATCACCTCCGGCAC
ATGATGGAGCTGAGCCGCGGGAAGAGAAGACAGAAAGCTTCGTCCAGGGGCTTTCTCGACTGGGTTTCTTGCCTG
GGTGCTGCTGTGTGGAGGGCGGGATTCGCGATGCAGCTGGTTGGTCACCTTGTTGCTGTTGCGCCGTTGCTGAAG
GATGGAGGTGATGGGCTGCGAGACCCGGCCGAGGGGCTTTCGTTCATGGTCCGGCTCGGGGGCTTGGCCGATGGG
CTTCCTTTGCCGGAATGGTTTGCTCGCTGGGGTTTTGTGGCGGCGGCTGCGGCGGTGTGGTGGAATCCTTACTTT
GTGCAGCTGGTTCGAGGCTTTACGAGGCATCTCTCGGGGTTTTCGCAGTGGTATTCTTTTCAGGGGCTGGTTGTT
GTCTCCCGGTTCATCTGCTGGGGGCTTGTTGGTGGCGGTATCGAGGGACAGACTCGTCAGGCGAGCATCAGCATT
CACGTGGCTATGGCGGCGGTCACGATGCTGATGTACCTCGTCATGGGAAGGTCGATTCGCGTCGACACACGGCCT
CTTTTCGGCGTCGGAGTCAGTCCTGGACCCAAAGAGCCGGCCTCGTCTCCGTTGCGGAAGAGAGAAGAAGCGACC
AAGACGCTATCTGATATGCTCATTGACGCCCTCGAGTCGACGCCACAGAAACAGGGGAAACGGCCTGTGACGGAC
GTCTCTCCCAGTTCTCAGACGGGCTTCTCGCCCAGATCTCCCCCTCGACAGAGACGAGCTTACGAAGACCACCAT
GATATCGACACGGCTAGCCGTCTGCCGCAGCAGGTTCAATACGCCCAAGAGATGGACTGGTCTCCCGTGACGCCT
CGGCATCGCGCTCTGGCTCCCGCACAACAGTCTCCAAGCCGGGGGGGCATGGACACGGTCGAAAAGAGCCCCTTT
TGGTACAAGGTTCCGGCCGCGCCGGTGACGCCGGCACGACAGCTCCGGAACCCGCCGCGGGCACCTACGGCGAAG
CCGACGGCCACGGAAGCCCATCATAGCTACAACTTCTCGCCGGCCGCGACGCGTCAGAGTGGAAGCGGTGTGAGG
AGCACTGGCGTCGAGTTTCGGCAGCAGCAGTTTTTCGCTCCGGAGCGGGATGATGCCAATTCGTTGGCTGATCTG
TTGGGGCAGAGCTTTAGTTTGAGCCAGGAGGGGGATGAAGACGACGACGACGATGATGACGACGACGACGATGAC
GACGACGACGACGACGATGTTGGCGAGGAGAAGGGGCCGGAGATGAAGAAGAAGGGGATTACGGCGAAAGGGACG
AGCCGGAAGACTACGAGGGCTCGTCAAAGGGACAGCGCATGGTATCGCCGTCTCGAGCGTGTTGCGGCCATAATG
CTACCCATCCTATGGACGCTGACACTCTCCTCAACACTACCCTTCCGAACCGAGTGCCAGACGGCGATGATAGCC
CTCTCCGGCTTCTTATCCCTCCCGACCGCCGGCGCCGACAGCCACGACAAGCTCCGTGCAGCCTGGGCCACGGCC
GAGCTGGCAGCCTCGTGCTGGGTCTTGAGCGCCCTGTGGACGGACGAGGGACGACGGGCGTGGTGGTGCGGCGCG
GGTGTGTTGGCTTCGGGGGCGTTGAGGCGGCTCGGCATGGAACGTTGGATGCATGTACGAGGATGA
Transcript >Ophcf2|03747
ATGGCGCGCTTCGGACCTCTGAGCTGCTTCTACTGCGGGAGGCGATCTGGACTGCGGAACGATGGGAAGACGCGA
GAGTTCGTGTGCCGGTATTGCGAGGCGACCAACTACCTGGACGAGAAGGGCGAAATCACAGACCCTCCTGTTGCG
ACAGACTGTGATGCCGCGCCGACGACGATGCAGTTTGCTACCCCGAAGCGACCGGCCCCGACGGACAGCATCTTC
TGCGCGTCCTGCCTGAAGAACCAGTACCTTCTGACGACGTCGCTGGCTCAATACCTCCCCGACGACCCCTCCGAT
CCGGACTACGCGCCGCTGGAGCGCAACTATCACCGTTACCGTCGCGGTCTGGAGAAGCGATACCCGCAGGTATGC
GACTCTTGCGCCGACCGGGTCGAAGCCCGGCTCCGACAGGCGGGGTATACGGCCAAGACGGATCACCTCCGGCAC
ATGATGGAGCTGAGCCGCGGGAAGAGAAGACAGAAAGCTTCGTCCAGGGGCTTTCTCGACTGGGTTTCTTGCCTG
GGTGCTGCTGTGTGGAGGGCGGGATTCGCGATGCAGCTGGTTGGTCACCTTGTTGCTGTTGCGCCGTTGCTGAAG
GATGGAGGTGATGGGCTGCGAGACCCGGCCGAGGGGCTTTCGTTCATGGTCCGGCTCGGGGGCTTGGCCGATGGG
CTTCCTTTGCCGGAATGGTTTGCTCGCTGGGGTTTTGTGGCGGCGGCTGCGGCGGTGTGGTGGAATCCTTACTTT
GTGCAGCTGGTTCGAGGCTTTACGAGGCATCTCTCGGGGTTTTCGCAGTGGTATTCTTTTCAGGGGCTGGTTGTT
GTCTCCCGGTTCATCTGCTGGGGGCTTGTTGGTGGCGGTATCGAGGGACAGACTCGTCAGGCGAGCATCAGCATT
CACGTGGCTATGGCGGCGGTCACGATGCTGATGTACCTCGTCATGGGAAGGTCGATTCGCGTCGACACACGGCCT
CTTTTCGGCGTCGGAGTCAGTCCTGGACCCAAAGAGCCGGCCTCGTCTCCGTTGCGGAAGAGAGAAGAAGCGACC
AAGACGCTATCTGATATGCTCATTGACGCCCTCGAGTCGACGCCACAGAAACAGGGGAAACGGCCTGTGACGGAC
GTCTCTCCCAGTTCTCAGACGGGCTTCTCGCCCAGATCTCCCCCTCGACAGAGACGAGCTTACGAAGACCACCAT
GATATCGACACGGCTAGCCGTCTGCCGCAGCAGGTTCAATACGCCCAAGAGATGGACTGGTCTCCCGTGACGCCT
CGGCATCGCGCTCTGGCTCCCGCACAACAGTCTCCAAGCCGGGGGGGCATGGACACGGTCGAAAAGAGCCCCTTT
TGGTACAAGGTTCCGGCCGCGCCGGTGACGCCGGCACGACAGCTCCGGAACCCGCCGCGGGCACCTACGGCGAAG
CCGACGGCCACGGAAGCCCATCATAGCTACAACTTCTCGCCGGCCGCGACGCGTCAGAGTGGAAGCGGTGTGAGG
AGCACTGGCGTCGAGTTTCGGCAGCAGCAGTTTTTCGCTCCGGAGCGGGATGATGCCAATTCGTTGGCTGATCTG
TTGGGGCAGAGCTTTAGTTTGAGCCAGGAGGGGGATGAAGACGACGACGACGATGATGACGACGACGACGATGAC
GACGACGACGACGACGATGTTGGCGAGGAGAAGGGGCCGGAGATGAAGAAGAAGGGGATTACGGCGAAAGGGACG
AGCCGGAAGACTACGAGGGCTCGTCAAAGGGACAGCGCATGGTATCGCCGTCTCGAGCGTGTTGCGGCCATAATG
CTACCCATCCTATGGACGCTGACACTCTCCTCAACACTACCCTTCCGAACCGAGTGCCAGACGGCGATGATAGCC
CTCTCCGGCTTCTTATCCCTCCCGACCGCCGGCGCCGACAGCCACGACAAGCTCCGTGCAGCCTGGGCCACGGCC
GAGCTGGCAGCCTCGTGCTGGGTCTTGAGCGCCCTGTGGACGGACGAGGGACGACGGGCGTGGTGGTGCGGCGCG
GGTGTGTTGGCTTCGGGGGCGTTGAGGCGGCTCGGCATGGAACGTTGGATGCATGTACGAGGATGA
Gene >Ophcf2|03747
ATGGCGCGCTTCGGACCTCTGAGCTGCTTCTACTGCGGGAGGCGATCTGGACTGCGGAACGATGGGAAGACGCGA
GAGTTCGTGTGCCGGTATTGCGAGGCGACCAACTACCTGGACGAGGTCCGTTCTTTTCCTCTGGAATCTTGTTGG
CGATTCTTCTCGTTGGGGGATGGGACGCTGACTGGTCGGTAGAAGGGCGAAATCACAGACCCTCCTGTTGCGACA
GACTGTGATGCCGCGCCGACGACGATGCAGTTTGCTACCCCGAAGCGACCGGCCCCGACGGACAGCATCTTCTGC
GCGTCCTGCCTGAAGAACCAGTACCTTCTGACGACGTCGCTGGCTCAATACCTCCCCGACGACCCCTCCGATCCG
GACTACGCGCCGCTGGAGCGCAACTATCACCGTTACCGTCGCGGTCTGGAGAAGCGATACCCGCAGGTATGCGAC
TCTTGCGCCGACCGGGTCGAAGCCCGGCTCCGACAGGCGGGGTATACGGCCAAGACGGATCACCTCCGGCACATG
ATGGAGCTGAGCCGCGGGAAGAGAAGACAGAAAGCTTCGTCCAGGGGCTTTCTCGACTGGGTTTCTTGCCTGGGT
GCTGCTGTGTGGAGGGCGGGATTCGCGATGCAGCTGGTTGGTCACCTTGTTGCTGTTGCGCCGTTGCTGAAGGAT
GGAGGTGATGGGCTGCGAGACCCGGCCGAGGGGCTTTCGTTCATGGTCCGGCTCGGGGGCTTGGCCGATGGGCTT
CCTTTGCCGGAATGGTTTGCTCGCTGGGGTTTTGTGGCGGCGGCTGCGGCGGTGTGGTGGAATCCTTACTTTGTG
CAGCTGGTTCGAGGCTTTACGAGGCATCTCTCGGGGTTTTCGCAGTGGTATTCTTTTCAGGGGCTGGTTGTTGTC
TCCCGGTTCATCTGCTGGGGGCTTGTTGGTGGCGGTATCGAGGGACAGACTCGTCAGGCGAGCATCAGCATTCAC
GTGGCTATGGCGGCGGTCACGATGCTGGTAAGTTTGGGACAGACGATTGCGATCATGGGATTTACTGAGAGTCTG
ACAGATGTACCTCGTCATGGGAAGGTCGATTCGCGTCGACACACGGCCTCTTTTCGGCGTCGGAGTCAGTCCTGG
ACCCAAAGAGCCGGCCTCGTCTCCGTTGCGGAAGAGAGAAGAAGCGACCAAGACGCTATCTGATATGCTCATTGA
CGCCCTCGAGTCGACGCCACAGAAACAGGGGAAACGGCCTGTGACGGACGTCTCTCCCAGTTCTCAGACGGGCTT
CTCGCCCAGATCTCCCCCTCGACAGAGACGAGCTTACGAAGACCACCATGATATCGACACGGCTAGCCGTCTGCC
GCAGCAGGTTCAATACGCCCAAGAGATGGACTGGTCTCCCGTGACGCCTCGGCATCGCGCTCTGGCTCCCGCACA
ACAGTCTCCAAGCCGGGGGGGCATGGACACGGTCGAAAAGAGCCCCTTTTGGTACAAGGTTCCGGCCGCGCCGGT
GACGCCGGCACGACAGCTCCGGAACCCGCCGCGGGCACCTACGGCGAAGCCGACGGCCACGGAAGCCCATCATAG
CTACAACTTCTCGCCGGCCGCGACGCGTCAGAGTGGAAGCGGTGTGAGGAGCACTGGCGTCGAGTTTCGGCAGCA
GCAGTTTTTCGCTCCGGAGCGGGATGATGCCAATTCGTTGGCTGATCTGTTGGGGCAGAGCTTTAGTTTGAGCCA
GGAGGGGGATGAAGACGACGACGACGATGATGACGACGACGACGATGACGACGACGACGACGACGATGTTGGCGA
GGAGAAGGGGCCGGAGATGAAGAAGAAGGGGATTACGGCGAAAGGGACGAGCCGGAAGACTACGAGGGCTCGTCA
AAGGGACAGCGCATGGTATCGCCGTCTCGAGCGTGTTGCGGCCATAATGCTACCCATCCTATGGACGCTGACACT
CTCCTCAACACTACCCTTCCGAACCGAGTGCCAGACGGCGATGATAGCCCTCTCCGGCTTCTTATCCCTCCCGAC
CGCCGGCGCCGACAGCCACGACAAGCTCCGTGCAGCCTGGGCCACGGCCGAGCTGGCAGCCTCGTGCTGGGTCTT
GAGCGCCCTGTGGACGGACGAGGGACGACGGGCGTGGTGGTGCGGCGCGGGTGTGTTGGCTTCGGGGGCGTTGAG
GCGGCTCGGCATGGAACGTTGGATGCATGTACGAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail