Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03739
Gene name
Locationscaffold_03:3702832..3703857
Strand-
Gene length (bp)1025
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03162 Y_phosphatase2 Tyrosine phosphatase family 5.5E-44 109 258
PF13350 Y_phosphatase3 Tyrosine phosphatase family 1.1E-09 182 234

GO

GO Term Description Terminal node
GO:0004721 phosphoprotein phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 274 291 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03739
MTSKRNSRVYTDEAAFRADSNSANCSQRARHDSYGSVDDDASLEHGEGQRAARAARDHSSATSRAPSLTRGERDA
SATSANRPGDKMTSAAPVKASSVTRSPAGTFVGRPANFGVVLPGVFRSSYPQPEDYAFLQSLQLKTIVTLVNKEG
GDDSLSSFVTSNGIRQIVFDMKGTKKEAIPPATMASILNVVLDRNQYPLMVHCNHGKHRTGCVVAVVRKLSGWTV
NTVLDEYRAYATPKVRECDVDYISSFKASTLITSTRPPLPMATVQHRNFFRLVVFSTFIIVLWLVSGSKLGMLSG
RLAAS*
Coding >Ophcf2|03739
ATGACTTCCAAACGCAACTCGCGCGTCTACACCGACGAAGCAGCCTTCCGGGCAGACAGCAACTCGGCCAACTGC
TCCCAACGCGCCCGCCACGATTCCTACGGCTCCGTCGACGACGACGCGTCGCTGGAACACGGAGAGGGTCAACGC
GCCGCTCGTGCCGCCAGGGATCACTCGTCTGCCACGTCCCGGGCCCCAAGCCTCACCCGTGGAGAGAGAGACGCG
TCGGCCACGTCTGCCAACAGGCCCGGAGATAAGATGACTTCCGCCGCTCCCGTCAAGGCTTCGTCCGTGACTCGC
TCGCCTGCTGGCACGTTCGTCGGCCGGCCGGCCAACTTTGGCGTCGTCCTCCCTGGCGTCTTCCGGAGTAGCTAT
CCTCAGCCGGAAGATTACGCCTTTTTGCAGAGCCTTCAGCTCAAGACTATCGTCACCTTGGTCAACAAGGAGGGC
GGCGACGACAGCCTCTCATCCTTTGTCACCAGCAATGGCATCCGTCAGATCGTCTTCGACATGAAAGGCACCAAG
AAGGAGGCCATCCCTCCCGCCACCATGGCCTCGATCCTCAATGTCGTCTTGGACCGCAATCAGTATCCCCTGATG
GTACATTGCAATCACGGCAAGCACCGCACCGGCTGCGTCGTCGCCGTCGTCAGGAAGCTCTCCGGATGGACTGTC
AACACGGTGCTGGACGAGTACCGAGCCTACGCTACGCCCAAGGTTCGTGAGTGCGACGTCGACTACATTAGCAGT
TTCAAGGCTTCGACGCTCATCACCTCGACCCGGCCTCCGTTACCCATGGCCACGGTTCAGCACCGCAATTTCTTC
CGCCTCGTCGTCTTCTCCACTTTCATCATCGTCCTCTGGCTCGTCTCGGGCTCCAAGCTGGGCATGTTGTCGGGC
CGCCTCGCCGCCTCCTGA
Transcript >Ophcf2|03739
ATGACTTCCAAACGCAACTCGCGCGTCTACACCGACGAAGCAGCCTTCCGGGCAGACAGCAACTCGGCCAACTGC
TCCCAACGCGCCCGCCACGATTCCTACGGCTCCGTCGACGACGACGCGTCGCTGGAACACGGAGAGGGTCAACGC
GCCGCTCGTGCCGCCAGGGATCACTCGTCTGCCACGTCCCGGGCCCCAAGCCTCACCCGTGGAGAGAGAGACGCG
TCGGCCACGTCTGCCAACAGGCCCGGAGATAAGATGACTTCCGCCGCTCCCGTCAAGGCTTCGTCCGTGACTCGC
TCGCCTGCTGGCACGTTCGTCGGCCGGCCGGCCAACTTTGGCGTCGTCCTCCCTGGCGTCTTCCGGAGTAGCTAT
CCTCAGCCGGAAGATTACGCCTTTTTGCAGAGCCTTCAGCTCAAGACTATCGTCACCTTGGTCAACAAGGAGGGC
GGCGACGACAGCCTCTCATCCTTTGTCACCAGCAATGGCATCCGTCAGATCGTCTTCGACATGAAAGGCACCAAG
AAGGAGGCCATCCCTCCCGCCACCATGGCCTCGATCCTCAATGTCGTCTTGGACCGCAATCAGTATCCCCTGATG
GTACATTGCAATCACGGCAAGCACCGCACCGGCTGCGTCGTCGCCGTCGTCAGGAAGCTCTCCGGATGGACTGTC
AACACGGTGCTGGACGAGTACCGAGCCTACGCTACGCCCAAGGTTCGTGAGTGCGACGTCGACTACATTAGCAGT
TTCAAGGCTTCGACGCTCATCACCTCGACCCGGCCTCCGTTACCCATGGCCACGGTTCAGCACCGCAATTTCTTC
CGCCTCGTCGTCTTCTCCACTTTCATCATCGTCCTCTGGCTCGTCTCGGGCTCCAAGCTGGGCATGTTGTCGGGC
CGCCTCGCCGCCTCCTGA
Gene >Ophcf2|03739
ATGACTTCCAAACGCAACTCGCGCGTCTACACCGACGAAGCAGCCTTCCGGGCAGACAGCAACTCGGCCAACTGC
TCCCAACGCGCCCGCCACGATTCCTACGGCTCCGTCGACGACGACGCGTCGCTGGAACACGGAGAGGGTCAACGC
GCCGCTCGTGCCGCCAGGGATCACTCGTCTGCCACGTCCCGGGCCCCAAGCCTCACCCGTGGAGAGAGAGACGCG
TCGGCCACGTCTGCCAACAGGCCCGGAGATAAGATGAGTGAGTTTCTGCGGCTCGCCTGACACGTGGGGCCCGGA
CTGACCGTGACAGCTTCCGCCGCTCCCGTCAAGGCTTCGTCCGTGACTCGCTCGCCTGCTGGCACGTTCGTCGGC
CGGCCGGCCAACTTTGGCGTCGTCCTCCCTGGCGTCTTCCGGAGTAGCTATCCTCAGCCGGAAGATTACGCCTTT
TTGCAGAGCCTTCAGCTCAAGACTATCGTGTAAGCCCCTCGCCGTCTCATGGGTCATCATTCCCTTTACTGACAT
GGTCTTTCAGCACCTTGGTCAACAAGGAGGGCGGCGACGACAGCCTCTCATCCTTTGTCACCAGCAATGGCATCC
GTCAGATCGTCTTCGACATGAAAGGCACCAAGAAGGAGGCCATCCCTCCCGCCACCATGGCCTCGATCCTCAATG
TCGTCTTGGACCGCAATCAGTATCCCCTGATGGTACATTGCAATCACGGCAAGCACCGCACCGGCTGCGTCGTCG
CCGTCGTCAGGAAGCTCTCCGGATGGACTGTCAACACGGTGCTGGACGAGTACCGAGCCTACGCTACGCCCAAGG
TTCGTGAGTGCGACGTCGACTACATTAGCAGTTTCAAGGCTTCGACGCTCATCACCTCGACCCGGCCTCCGTTAC
CCATGGCCACGGTTCAGCACCGCAATTTCTTCCGCCTCGTCGTCTTCTCCACTTTCATCATCGTCCTCTGGCTCG
TCTCGGGCTCCAAGCTGGGCATGTTGTCGGGCCGCCTCGCCGCCTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail