Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03728
Gene name
Locationscaffold_03:3658485..3659629
Strand+
Gene length (bp)1144
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 5.4E-41 5 181
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 2.5E-08 186 275

GO

GO Term Description Terminal node
GO:0006631 fatty acid metabolic process Yes
GO:0070403 NAD+ binding Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0051287 NAD binding No
GO:0044255 cellular lipid metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0036094 small molecule binding No
GO:0006082 organic acid metabolic process No
GO:0043167 ion binding No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Peroxisome Peroxisomal targeting signal 0.7467 0.3579 0.0104 0.1014 0.3365 0.1015 0.0818 0.0914 0.0725 0.8594

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.35 0.0 0.84
Alive In ants, during behavior modification 0.61 0.0 1.51
Dead In ants, recently dead 0.28 0.0 0.72

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Orthologs

Orthofinder run ID4
Orthogroup5873
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2049
Ophiocordyceps australis map64 (Brazil) OphauB2|3693
Ophiocordyceps australis map64 (Brazil) OphauB2|696
Ophiocordyceps camponoti-floridani Ophcf2|03728 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4706
Ophiocordyceps kimflemingae Ophio5|4590

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03728
MAIRTVGVIGTGVIGSSWIGLFLAHGFRVLVSDPASGAEEKLEEYLKSIWPTLKDIGLASGASLSNYTFVGAAMD
KHYHEVDFVQENAPERVDLKTKLLGEIDAGTRPDVVIASSSSGIPSSQFISQCAKNPGRVLIGHPFNPPHLMKLV
EVVPHPKTDKAMIEEAMSFYRSLGRHPVHLRQEVPGFAANRLQAALCSEAYSLVSRGILSAEDLDACVTNSLGPR
WAVVGPMMANAMGGGGGSEGFRHLLEHLGPATLEWKKDMDKHAFQWNKAGIDALADSVAKELEGKSVDEVAEKRD
KQLVQLFRIKDGKTSG*
Coding >Ophcf2|03728
ATGGCTATTCGAACTGTGGGCGTCATAGGCACCGGAGTGATTGGGTCTTCCTGGATAGGACTCTTTCTGGCCCAT
GGGTTTCGAGTTCTGGTCTCGGACCCGGCTTCCGGCGCCGAAGAGAAGCTGGAAGAGTACCTCAAGAGCATCTGG
CCTACGCTGAAGGACATTGGGCTGGCTTCCGGGGCGTCGCTGTCAAACTATACCTTTGTTGGTGCCGCTATGGAC
AAGCATTACCACGAGGTCGATTTTGTTCAAGAGAATGCGCCGGAACGCGTGGACCTGAAGACCAAGCTCCTGGGC
GAGATCGACGCCGGCACACGACCAGATGTAGTGATAGCCTCATCGTCATCCGGCATTCCAAGCTCTCAGTTCATC
TCTCAATGCGCCAAGAATCCTGGCCGTGTTCTCATCGGCCATCCGTTCAACCCACCTCATCTCATGAAGCTGGTC
GAGGTCGTCCCACATCCCAAGACGGACAAGGCCATGATTGAGGAAGCCATGAGCTTTTACCGCTCTCTCGGTCGT
CACCCTGTTCACCTTCGGCAAGAGGTCCCTGGCTTTGCTGCCAACCGACTTCAGGCCGCTCTCTGCTCGGAAGCG
TATAGCTTAGTTAGTCGGGGCATTCTTTCTGCTGAGGACCTCGATGCCTGTGTTACCAACAGCCTCGGACCTCGC
TGGGCGGTGGTAGGCCCTATGATGGCAAACGCCATGGGCGGAGGCGGTGGCTCCGAAGGCTTCAGGCATCTTTTG
GAGCACCTTGGTCCCGCGACGCTGGAATGGAAGAAGGATATGGACAAGCATGCTTTCCAGTGGAATAAGGCGGGT
ATTGATGCGCTGGCCGATAGCGTTGCGAAGGAGCTCGAGGGGAAGAGTGTGGATGAGGTCGCGGAGAAGCGGGAT
AAACAGCTTGTTCAGCTGTTCCGTATCAAGGATGGGAAAACGTCTGGTTAG
Transcript >Ophcf2|03728
ATGGCTATTCGAACTGTGGGCGTCATAGGCACCGGAGTGATTGGGTCTTCCTGGATAGGACTCTTTCTGGCCCAT
GGGTTTCGAGTTCTGGTCTCGGACCCGGCTTCCGGCGCCGAAGAGAAGCTGGAAGAGTACCTCAAGAGCATCTGG
CCTACGCTGAAGGACATTGGGCTGGCTTCCGGGGCGTCGCTGTCAAACTATACCTTTGTTGGTGCCGCTATGGAC
AAGCATTACCACGAGGTCGATTTTGTTCAAGAGAATGCGCCGGAACGCGTGGACCTGAAGACCAAGCTCCTGGGC
GAGATCGACGCCGGCACACGACCAGATGTAGTGATAGCCTCATCGTCATCCGGCATTCCAAGCTCTCAGTTCATC
TCTCAATGCGCCAAGAATCCTGGCCGTGTTCTCATCGGCCATCCGTTCAACCCACCTCATCTCATGAAGCTGGTC
GAGGTCGTCCCACATCCCAAGACGGACAAGGCCATGATTGAGGAAGCCATGAGCTTTTACCGCTCTCTCGGTCGT
CACCCTGTTCACCTTCGGCAAGAGGTCCCTGGCTTTGCTGCCAACCGACTTCAGGCCGCTCTCTGCTCGGAAGCG
TATAGCTTAGTTAGTCGGGGCATTCTTTCTGCTGAGGACCTCGATGCCTGTGTTACCAACAGCCTCGGACCTCGC
TGGGCGGTGGTAGGCCCTATGATGGCAAACGCCATGGGCGGAGGCGGTGGCTCCGAAGGCTTCAGGCATCTTTTG
GAGCACCTTGGTCCCGCGACGCTGGAATGGAAGAAGGATATGGACAAGCATGCTTTCCAGTGGAATAAGGCGGGT
ATTGATGCGCTGGCCGATAGCGTTGCGAAGGAGCTCGAGGGGAAGAGTGTGGATGAGGTCGCGGAGAAGCGGGAT
AAACAGCTTGTTCAGCTGTTCCGTATCAAGGATGGGAAAACGTCTGGTTAG
Gene >Ophcf2|03728
ATGGCTATTCGAACTGTGGGCGTCATAGGCACCGGAGTGATTGGGTCTTCCTGGATAGGACTCTTTCTGGCCCAT
GGGTTTCGAGTTCTGGTCTCGGACCCGGCTTCCGGCGCCGAAGAGAAGCTGGAAGAGTACCTCAAGAGCATCTGG
CCTACGCTGAAGGACATTGGGCTGGCTTCCGGGGCGTCGCTGTCAAACTATACCTTTGTTGGTGCCGCTATGGAC
AAGCATTACCACGAGGTCGATTTTGTTCAAGAGGTGAGCAATCATTCGGTTGACTGGTATGGCCGTTTGTCTGTA
CCGAGTGAGATGCACGAGAGCGGCTTCATGCAGAGAACCAGCCGTATGTATGACGTTGTTCTGACAATCACCTCC
AGAATGCGCCGGAACGCGTGGACCTGAAGACCAAGCTCCTGGGCGAGATCGACGCCGGCACACGACCAGATGTAG
TGATAGCCTCATCGTCATCCGGCATTCCAAGCTCTCAGTTCATCTCTCAATGCGCCAAGAATCCTGGCCGTGTTC
TCATCGGCCATCCGTTCAACCCACCTCATCTCATGAAGCTGGTCGAGGTCGTCCCACATCCCAAGACGGACAAGG
CCATGATTGAGGAAGCCATGAGCTTTTACCGCTCTCTCGGTCGTCACCCTGTTCACCTTCGGCAAGAGGTCCCTG
GCTTTGCTGCCAACCGACTTCAGGCCGCTCTCTGCTCGGAAGCGTATAGCTTAGTTAGTCGGGGCATTCTTTCTG
CTGAGGACCTCGGTGAGTACATTTTTCCGCCGACTGCGTTGTGATACCTCCATGTTTCACTTCATACGCGGCTAA
TAACTCCTCAGATGCCTGTGTTACCAACAGCCTCGGACCTCGCTGGGCGGTGGTAGGCCCTATGATGGCAAACGC
CATGGGCGGAGGCGGTGGCTCCGAAGGCTTCAGGCATCTTTTGGAGCACCTTGGTCCCGCGACGCTGGAATGGAA
GAAGGATATGGACAAGCATGCTTTCCAGTGGAATAAGGCGGGTATTGATGCGCTGGCCGATAGCGTTGCGAAGGA
GCTCGAGGGGAAGAGTGTGGATGAGGTCGCGGAGAAGCGGGATAAACAGCTTGTTCAGCTGTTCCGTATCAAGGA
TGGGAAAACGTCTGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail