Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03728
Gene name
Locationscaffold_03:3658485..3659629
Strand+
Gene length (bp)1144
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 5.4E-41 5 181
PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain 2.5E-08 186 275

GO

GO Term Description Terminal node
GO:0006631 fatty acid metabolic process Yes
GO:0070403 NAD+ binding Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0051287 NAD binding No
GO:0044255 cellular lipid metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0036094 small molecule binding No
GO:0006082 organic acid metabolic process No
GO:0043167 ion binding No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03728
MAIRTVGVIGTGVIGSSWIGLFLAHGFRVLVSDPASGAEEKLEEYLKSIWPTLKDIGLASGASLSNYTFVGAAMD
KHYHEVDFVQENAPERVDLKTKLLGEIDAGTRPDVVIASSSSGIPSSQFISQCAKNPGRVLIGHPFNPPHLMKLV
EVVPHPKTDKAMIEEAMSFYRSLGRHPVHLRQEVPGFAANRLQAALCSEAYSLVSRGILSAEDLDACVTNSLGPR
WAVVGPMMANAMGGGGGSEGFRHLLEHLGPATLEWKKDMDKHAFQWNKAGIDALADSVAKELEGKSVDEVAEKRD
KQLVQLFRIKDGKTSG*
Coding >Ophcf2|03728
ATGGCTATTCGAACTGTGGGCGTCATAGGCACCGGAGTGATTGGGTCTTCCTGGATAGGACTCTTTCTGGCCCAT
GGGTTTCGAGTTCTGGTCTCGGACCCGGCTTCCGGCGCCGAAGAGAAGCTGGAAGAGTACCTCAAGAGCATCTGG
CCTACGCTGAAGGACATTGGGCTGGCTTCCGGGGCGTCGCTGTCAAACTATACCTTTGTTGGTGCCGCTATGGAC
AAGCATTACCACGAGGTCGATTTTGTTCAAGAGAATGCGCCGGAACGCGTGGACCTGAAGACCAAGCTCCTGGGC
GAGATCGACGCCGGCACACGACCAGATGTAGTGATAGCCTCATCGTCATCCGGCATTCCAAGCTCTCAGTTCATC
TCTCAATGCGCCAAGAATCCTGGCCGTGTTCTCATCGGCCATCCGTTCAACCCACCTCATCTCATGAAGCTGGTC
GAGGTCGTCCCACATCCCAAGACGGACAAGGCCATGATTGAGGAAGCCATGAGCTTTTACCGCTCTCTCGGTCGT
CACCCTGTTCACCTTCGGCAAGAGGTCCCTGGCTTTGCTGCCAACCGACTTCAGGCCGCTCTCTGCTCGGAAGCG
TATAGCTTAGTTAGTCGGGGCATTCTTTCTGCTGAGGACCTCGATGCCTGTGTTACCAACAGCCTCGGACCTCGC
TGGGCGGTGGTAGGCCCTATGATGGCAAACGCCATGGGCGGAGGCGGTGGCTCCGAAGGCTTCAGGCATCTTTTG
GAGCACCTTGGTCCCGCGACGCTGGAATGGAAGAAGGATATGGACAAGCATGCTTTCCAGTGGAATAAGGCGGGT
ATTGATGCGCTGGCCGATAGCGTTGCGAAGGAGCTCGAGGGGAAGAGTGTGGATGAGGTCGCGGAGAAGCGGGAT
AAACAGCTTGTTCAGCTGTTCCGTATCAAGGATGGGAAAACGTCTGGTTAG
Transcript >Ophcf2|03728
ATGGCTATTCGAACTGTGGGCGTCATAGGCACCGGAGTGATTGGGTCTTCCTGGATAGGACTCTTTCTGGCCCAT
GGGTTTCGAGTTCTGGTCTCGGACCCGGCTTCCGGCGCCGAAGAGAAGCTGGAAGAGTACCTCAAGAGCATCTGG
CCTACGCTGAAGGACATTGGGCTGGCTTCCGGGGCGTCGCTGTCAAACTATACCTTTGTTGGTGCCGCTATGGAC
AAGCATTACCACGAGGTCGATTTTGTTCAAGAGAATGCGCCGGAACGCGTGGACCTGAAGACCAAGCTCCTGGGC
GAGATCGACGCCGGCACACGACCAGATGTAGTGATAGCCTCATCGTCATCCGGCATTCCAAGCTCTCAGTTCATC
TCTCAATGCGCCAAGAATCCTGGCCGTGTTCTCATCGGCCATCCGTTCAACCCACCTCATCTCATGAAGCTGGTC
GAGGTCGTCCCACATCCCAAGACGGACAAGGCCATGATTGAGGAAGCCATGAGCTTTTACCGCTCTCTCGGTCGT
CACCCTGTTCACCTTCGGCAAGAGGTCCCTGGCTTTGCTGCCAACCGACTTCAGGCCGCTCTCTGCTCGGAAGCG
TATAGCTTAGTTAGTCGGGGCATTCTTTCTGCTGAGGACCTCGATGCCTGTGTTACCAACAGCCTCGGACCTCGC
TGGGCGGTGGTAGGCCCTATGATGGCAAACGCCATGGGCGGAGGCGGTGGCTCCGAAGGCTTCAGGCATCTTTTG
GAGCACCTTGGTCCCGCGACGCTGGAATGGAAGAAGGATATGGACAAGCATGCTTTCCAGTGGAATAAGGCGGGT
ATTGATGCGCTGGCCGATAGCGTTGCGAAGGAGCTCGAGGGGAAGAGTGTGGATGAGGTCGCGGAGAAGCGGGAT
AAACAGCTTGTTCAGCTGTTCCGTATCAAGGATGGGAAAACGTCTGGTTAG
Gene >Ophcf2|03728
ATGGCTATTCGAACTGTGGGCGTCATAGGCACCGGAGTGATTGGGTCTTCCTGGATAGGACTCTTTCTGGCCCAT
GGGTTTCGAGTTCTGGTCTCGGACCCGGCTTCCGGCGCCGAAGAGAAGCTGGAAGAGTACCTCAAGAGCATCTGG
CCTACGCTGAAGGACATTGGGCTGGCTTCCGGGGCGTCGCTGTCAAACTATACCTTTGTTGGTGCCGCTATGGAC
AAGCATTACCACGAGGTCGATTTTGTTCAAGAGGTGAGCAATCATTCGGTTGACTGGTATGGCCGTTTGTCTGTA
CCGAGTGAGATGCACGAGAGCGGCTTCATGCAGAGAACCAGCCGTATGTATGACGTTGTTCTGACAATCACCTCC
AGAATGCGCCGGAACGCGTGGACCTGAAGACCAAGCTCCTGGGCGAGATCGACGCCGGCACACGACCAGATGTAG
TGATAGCCTCATCGTCATCCGGCATTCCAAGCTCTCAGTTCATCTCTCAATGCGCCAAGAATCCTGGCCGTGTTC
TCATCGGCCATCCGTTCAACCCACCTCATCTCATGAAGCTGGTCGAGGTCGTCCCACATCCCAAGACGGACAAGG
CCATGATTGAGGAAGCCATGAGCTTTTACCGCTCTCTCGGTCGTCACCCTGTTCACCTTCGGCAAGAGGTCCCTG
GCTTTGCTGCCAACCGACTTCAGGCCGCTCTCTGCTCGGAAGCGTATAGCTTAGTTAGTCGGGGCATTCTTTCTG
CTGAGGACCTCGGTGAGTACATTTTTCCGCCGACTGCGTTGTGATACCTCCATGTTTCACTTCATACGCGGCTAA
TAACTCCTCAGATGCCTGTGTTACCAACAGCCTCGGACCTCGCTGGGCGGTGGTAGGCCCTATGATGGCAAACGC
CATGGGCGGAGGCGGTGGCTCCGAAGGCTTCAGGCATCTTTTGGAGCACCTTGGTCCCGCGACGCTGGAATGGAA
GAAGGATATGGACAAGCATGCTTTCCAGTGGAATAAGGCGGGTATTGATGCGCTGGCCGATAGCGTTGCGAAGGA
GCTCGAGGGGAAGAGTGTGGATGAGGTCGCGGAGAAGCGGGATAAACAGCTTGTTCAGCTGTTCCGTATCAAGGA
TGGGAAAACGTCTGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail