Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03717
Gene name
Locationscaffold_03:3633012..3633795
Strand+
Gene length (bp)783
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 1.3E-05 47 220

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.7113 0.6756 0.0095 0.0265 0.6319 0.1198 0.1 0.2821 0.1489 0.2739

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6388
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4967
Ophiocordyceps australis map64 (Brazil) OphauB2|3938
Ophiocordyceps camponoti-floridani Ophcf2|03717 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4693
Ophiocordyceps kimflemingae Ophio5|3412

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03717
MSSPRSNLVDIFTRRLNAFHASGLPLQILSTHPCPTSTLPTRLLVLDSSFNPPTRAHTQMARAAMRQHDGLMLLL
SVANADKRVQPAGFASRLCLMEVLARKMAVDGIVVDLAVTTRPLFADKVAPVAGSGVYEEVIFLVGFDTLIRILD
VKYYDDADKMNMVLASFFRRARLLVFIRPSEEWGSVAEQRRFVEESEWTSYIQVRLDNGTEGVSSSRVRELVRMP
GGARRDDELARLVDDDVLNWIESENLYRTDVHNSS*
Coding >Ophcf2|03717
ATGTCCTCTCCAAGGAGCAACCTCGTCGACATCTTCACCCGCCGTCTGAACGCATTCCACGCCTCTGGCCTCCCC
CTCCAGATCCTCAGCACGCACCCGTGTCCGACGTCAACGCTGCCCACGCGCCTGCTGGTGCTGGACTCGAGCTTC
AACCCTCCGACGAGGGCGCATACGCAGATGGCGCGCGCCGCGATGCGCCAACATGATGGGCTTATGCTGTTACTT
TCTGTCGCGAATGCGGATAAGAGGGTTCAGCCTGCGGGGTTTGCCTCGCGGTTGTGCTTGATGGAGGTGCTGGCA
AGGAAGATGGCGGTGGATGGGATTGTGGTTGACTTGGCTGTCACGACGAGGCCTCTCTTCGCGGACAAGGTTGCT
CCTGTGGCGGGTAGTGGCGTCTATGAGGAGGTTATCTTCCTCGTTGGCTTCGACACGCTGATTCGAATCCTTGAC
GTGAAATACTACGACGACGCCGATAAGATGAACATGGTTCTCGCCTCGTTCTTCCGTCGCGCTCGCCTGCTTGTC
TTCATCAGACCGTCTGAAGAATGGGGTTCGGTGGCCGAGCAGCGTCGGTTCGTAGAAGAGAGCGAGTGGACGAGC
TACATCCAGGTTCGTCTTGATAATGGGACGGAGGGTGTTAGCAGCTCGCGGGTGAGGGAGCTGGTCCGTATGCCT
GGGGGAGCTCGACGGGATGATGAGCTGGCGCGGCTGGTGGATGATGATGTTTTGAATTGGATTGAGAGTGAGAAT
CTATATCGCACTGATGTACACAATTCATCCTGA
Transcript >Ophcf2|03717
ATGTCCTCTCCAAGGAGCAACCTCGTCGACATCTTCACCCGCCGTCTGAACGCATTCCACGCCTCTGGCCTCCCC
CTCCAGATCCTCAGCACGCACCCGTGTCCGACGTCAACGCTGCCCACGCGCCTGCTGGTGCTGGACTCGAGCTTC
AACCCTCCGACGAGGGCGCATACGCAGATGGCGCGCGCCGCGATGCGCCAACATGATGGGCTTATGCTGTTACTT
TCTGTCGCGAATGCGGATAAGAGGGTTCAGCCTGCGGGGTTTGCCTCGCGGTTGTGCTTGATGGAGGTGCTGGCA
AGGAAGATGGCGGTGGATGGGATTGTGGTTGACTTGGCTGTCACGACGAGGCCTCTCTTCGCGGACAAGGTTGCT
CCTGTGGCGGGTAGTGGCGTCTATGAGGAGGTTATCTTCCTCGTTGGCTTCGACACGCTGATTCGAATCCTTGAC
GTGAAATACTACGACGACGCCGATAAGATGAACATGGTTCTCGCCTCGTTCTTCCGTCGCGCTCGCCTGCTTGTC
TTCATCAGACCGTCTGAAGAATGGGGTTCGGTGGCCGAGCAGCGTCGGTTCGTAGAAGAGAGCGAGTGGACGAGC
TACATCCAGGTTCGTCTTGATAATGGGACGGAGGGTGTTAGCAGCTCGCGGGTGAGGGAGCTGGTCCGTATGCCT
GGGGGAGCTCGACGGGATGATGAGCTGGCGCGGCTGGTGGATGATGATGTTTTGAATTGGATTGAGAGTGAGAAT
CTATATCGCACTGATGTACACAATTCATCCTGA
Gene >Ophcf2|03717
ATGTCCTCTCCAAGGAGCAACCTCGTCGACATCTTCACCCGCCGTCTGAACGCATTCCACGCCTCTGGCCTCCCC
CTCCAGATCCTCAGCACGCACCCGTGTCCGACGTCAACGCTGCCCACGCGCCTGCTGGTGCTGGACTCGAGCTTC
AACCCTCCGACGAGGGCGCATACGCAGATGGCGCGCGCCGCGATGCGCCAACATGATGGGCTTATGCTGTTACTT
TCTGTCGCGAATGCGGATAAGAGGGTTCAGCCTGCGGGGTTTGCCTCGCGGTTGTGCTTGATGGAGGTGCTGGCA
AGGAAGATGGCGGTGGATGGGATTGTGGTTGACTTGGCTGTCACGACGAGGCCTCTCTTCGCGGACAAGGTTGCT
CCTGTGGCGGGTAGTGGCGTCTATGAGGAGGTTATCTTCCTCGTTGGCTTCGACACGCTGATTCGAATCCTTGAC
GTGAAATACTACGACGACGCCGATAAGATGAACATGGTTCTCGCCTCGTTCTTCCGTCGCGCTCGCCTGCTTGTC
TTCATCAGACCGTCTGAAGAATGGGGTTCGGTGGCCGAGCAGCGTCGGTTCGTAGAAGAGAGCGAGTGGACGAGC
TACATCCAGGTTCGTCTTGATAATGGGACGGAGGGTGTTAGCAGCTCGCGGGTGAGGGAGCTGGTCCGTATGCCT
GGGGGAGCTCGACGGGATGATGAGCTGGCGCGGCTGGTGGATGATGATGTTTTGAATTGGATTGAGAGTGAGAAT
CTATATCGCACTGATGTACACAATTCATCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail