Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03715
Gene name
Locationscaffold_03:3628068..3631333
Strand+
Gene length (bp)3265
Transcript length (bp)2955
Coding sequence length (bp)2955
Protein length (aa) 985

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00637 Clathrin Region in Clathrin and VPS 1.0E-21 404 536
PF12451 VPS11_C Vacuolar protein sorting protein 11 C terminal 6.9E-16 930 974
PF17122 zf-C3H2C3 Zinc-finger 2.4E-06 886 926

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071705 nitrogen compound transport No
GO:0046907 intracellular transport No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0015031 protein transport No
GO:0051179 localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Nuclear export signal 0.4634 0.466 0.0902 0.094 0.0433 0.0114 0.1424 0.766 0.3006 0.0074

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3186
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|961
Ophiocordyceps australis map64 (Brazil) OphauB2|5095
Ophiocordyceps camponoti-floridani Ophcf2|03715 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7364
Ophiocordyceps kimflemingae Ophio5|3415
Ophiocordyceps subramaniannii Hirsu2|5717

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03715
MAVSWKSFDFFEVSKVTLADDDVRQLFESSDISSVCAGSDSLFIGSNDGSVSIIGKSWKVIRKFQAHDNRRIAHM
RQVEGTSILVTVAEDLSGEPVLKAWALDQLIKKTNMPTCLSTLTINNGRRPYPITALAALEDLSQIAVGFGNGAV
TVIRGDLIHDLGTKQRIVFESEEPITGVQLVADEKLTTLFVSTTSRIIKLGLSRKGQGLPPKTAEDAGCAVDCMT
LDDNSGQVIIAREDAIYTYSVDGRGPPRAYESPKSFIALYQGYVALACPSSGSGGREPETMRRFGGDALLEASSF
VLLDTDLRLIAHTETLISPVRFVFSVWGMLFTIDLQGKVNQYREKDLQQRLEMLYQRNMFPLAIELAQNSGLDFK
QQSLIYRKFGDHLYQKGDYDGAMVQYIRAIDTTEPSQVIRKFLDTQRIHNLIQYLEQLHEHRKATADHTTLLLNC
YAKLKDIDKLETFIKSPGDLKFDLDTAIAMCRQGGYYEQAAYLAKRHGETELVVDILIEDSKSYAEALNFIWQQD
PEIAYPCLQKYARVLIENCPQDATLLFVEYYTGRYKPRREATVVQDDKTSQTAGFAASAVQNLSSLLPFPYMTSS
TLASPAAGILPRDPVGEGAAEAAAAATDAVDARAPEYTPPPPRTAFSSFIDHPDEFISFLEACLEEKYVRSSDKT
DLYTTLFEMYLQKSSDSKEQGDKSMWEEKAKRLIEGDHVPMESSNVLLLSHLSDFKQGTVLVKEQAGLLSDIFRS
YTSAKDTRGAMKALRKYGPDEPQLYPEALAYLASDPRVLDEAGSDELAGILSKIDKDGLMAPLQVIQTLVGQSTA
GGGVATVGMVKPYLHETITRERKEIEANRHRIDTLRADTDKRRAELSELGSKPAVFQATRCADCGQGLDLPAVHF
LCKHSFHQRCLRGGGGEEVQMECPKCSGENAVIRKMREGQRETAEKHELFKADVEASDDRFATMAEWFSRGVMDA
GRDTELPHA*
Coding >Ophcf2|03715
ATGGCCGTCTCATGGAAGTCGTTTGACTTCTTCGAAGTCTCCAAAGTCACTCTCGCTGACGACGACGTCCGCCAG
CTCTTCGAGAGCAGCGACATCTCCAGTGTCTGCGCCGGTTCCGATAGTCTGTTCATCGGCTCTAATGATGGCTCC
GTCAGCATCATCGGAAAGTCCTGGAAGGTGATCCGCAAGTTCCAGGCCCACGATAACAGGCGGATCGCGCATATG
CGCCAGGTCGAAGGCACCAGCATTCTGGTCACTGTCGCTGAGGATCTCAGTGGCGAGCCGGTTCTTAAGGCCTGG
GCCCTAGACCAGCTCATCAAAAAGACCAACATGCCCACCTGTCTCAGCACCCTGACCATTAACAATGGCAGGCGT
CCATATCCAATAACCGCTCTGGCCGCCCTCGAAGACCTGTCACAGATTGCCGTCGGCTTTGGCAACGGCGCCGTC
ACCGTGATCCGCGGCGACCTCATTCACGACCTTGGGACGAAGCAGCGCATCGTCTTCGAGTCCGAAGAGCCAATC
ACTGGCGTCCAACTCGTGGCCGACGAGAAACTGACCACCCTCTTCGTTTCCACAACCTCTCGCATCATCAAGCTG
GGCCTCTCTAGGAAGGGTCAGGGACTGCCGCCCAAGACGGCTGAGGATGCCGGATGTGCCGTGGACTGCATGACT
TTGGATGACAACTCCGGCCAGGTGATTATCGCGCGCGAAGATGCCATCTACACTTACTCGGTCGACGGAAGAGGC
CCGCCTCGAGCCTACGAATCGCCCAAGAGTTTCATCGCCTTGTATCAAGGCTACGTTGCTCTGGCCTGTCCGTCT
TCGGGCTCGGGCGGGCGGGAGCCGGAAACTATGAGGCGCTTCGGCGGCGACGCCCTTCTAGAAGCCTCGTCATTT
GTCCTTTTAGACACAGATCTGCGCCTGATTGCTCATACCGAGACGCTCATCTCCCCCGTCCGATTCGTCTTTAGC
GTCTGGGGGATGCTTTTCACAATTGACCTCCAGGGAAAAGTCAATCAATACCGTGAGAAGGATCTGCAGCAGAGA
CTGGAAATGCTGTACCAAAGAAACATGTTCCCGCTCGCCATCGAGCTAGCCCAAAACTCGGGTCTCGATTTTAAG
CAGCAGAGCCTCATCTACCGCAAGTTCGGTGACCACCTCTACCAGAAAGGAGACTATGACGGTGCCATGGTGCAG
TACATTCGAGCCATCGATACGACTGAACCATCCCAGGTGATTCGCAAGTTCCTCGACACACAGCGCATACACAAC
CTCATCCAGTACCTAGAGCAGTTGCACGAACATAGAAAGGCCACGGCCGATCACACGACTCTATTGCTCAACTGC
TACGCCAAGCTAAAGGACATTGACAAGCTGGAGACGTTCATCAAGTCGCCCGGCGATCTCAAGTTCGACCTTGAC
ACGGCCATCGCCATGTGCCGCCAGGGCGGATACTACGAGCAGGCCGCCTATCTGGCCAAGAGACACGGCGAGACG
GAGCTCGTCGTCGACATTTTGATCGAAGACTCAAAGAGCTACGCAGAGGCGCTCAACTTCATCTGGCAACAGGAT
CCAGAGATTGCCTATCCCTGTCTTCAAAAGTATGCTCGAGTCCTCATTGAAAACTGTCCTCAGGATGCGACTCTA
CTCTTCGTGGAGTACTACACAGGCAGATACAAGCCCAGGCGCGAGGCGACGGTGGTGCAAGACGATAAGACGTCT
CAGACGGCCGGATTCGCCGCAAGCGCCGTTCAAAACCTGTCCAGCCTGCTTCCTTTTCCCTACATGACGAGCTCG
ACCCTCGCGAGCCCGGCGGCTGGCATCCTGCCGAGGGATCCCGTCGGCGAAGGGGCCGCAGAAGCAGCTGCAGCG
GCAACGGATGCCGTCGACGCCCGTGCGCCCGAGTACACGCCGCCTCCGCCTAGAACGGCCTTTTCATCCTTTATC
GATCACCCGGACGAGTTCATCAGCTTTCTCGAAGCGTGTCTGGAAGAGAAGTACGTCAGGTCGTCGGACAAGACG
GATCTCTATACGACGCTCTTTGAGATGTACCTACAAAAGTCGAGCGACAGCAAAGAGCAAGGCGACAAGTCCATG
TGGGAAGAAAAGGCCAAGAGGCTCATTGAGGGGGATCATGTGCCGATGGAGAGCTCCAACGTTCTCCTGCTGTCG
CATCTTTCCGACTTTAAACAGGGCACGGTCCTAGTCAAGGAGCAGGCCGGCTTGTTGTCGGACATTTTCCGATCC
TATACGTCGGCCAAGGACACGCGAGGTGCCATGAAGGCGCTGCGCAAGTACGGACCGGACGAGCCGCAGTTGTAC
CCGGAGGCGCTGGCATACTTGGCCTCGGATCCGCGGGTTCTCGACGAGGCGGGATCGGATGAGCTGGCTGGTATC
CTGTCCAAGATTGACAAGGACGGGCTCATGGCTCCATTGCAGGTTATCCAGACGCTCGTGGGGCAATCGACGGCC
GGCGGCGGCGTGGCGACGGTGGGCATGGTCAAACCATACTTGCACGAGACCATCACACGGGAACGAAAGGAGATT
GAAGCGAACCGTCACCGCATCGACACGCTACGAGCCGACACGGACAAGCGACGGGCCGAGCTATCAGAGCTTGGC
AGCAAGCCAGCCGTCTTCCAGGCAACGCGGTGCGCCGACTGCGGCCAGGGACTTGACCTCCCTGCGGTGCATTTC
CTCTGCAAGCACAGCTTCCATCAGCGTTGTCTGCGCGGCGGCGGCGGTGAGGAGGTGCAGATGGAGTGTCCCAAG
TGTTCGGGGGAGAATGCCGTGATACGCAAGATGAGGGAGGGGCAGCGGGAAACGGCGGAGAAGCACGAGCTTTTC
AAGGCTGATGTTGAGGCTAGCGATGATCGATTTGCGACTATGGCTGAGTGGTTCTCGAGGGGGGTTATGGATGCT
GGGAGAGATACGGAGCTGCCGCATGCGTAG
Transcript >Ophcf2|03715
ATGGCCGTCTCATGGAAGTCGTTTGACTTCTTCGAAGTCTCCAAAGTCACTCTCGCTGACGACGACGTCCGCCAG
CTCTTCGAGAGCAGCGACATCTCCAGTGTCTGCGCCGGTTCCGATAGTCTGTTCATCGGCTCTAATGATGGCTCC
GTCAGCATCATCGGAAAGTCCTGGAAGGTGATCCGCAAGTTCCAGGCCCACGATAACAGGCGGATCGCGCATATG
CGCCAGGTCGAAGGCACCAGCATTCTGGTCACTGTCGCTGAGGATCTCAGTGGCGAGCCGGTTCTTAAGGCCTGG
GCCCTAGACCAGCTCATCAAAAAGACCAACATGCCCACCTGTCTCAGCACCCTGACCATTAACAATGGCAGGCGT
CCATATCCAATAACCGCTCTGGCCGCCCTCGAAGACCTGTCACAGATTGCCGTCGGCTTTGGCAACGGCGCCGTC
ACCGTGATCCGCGGCGACCTCATTCACGACCTTGGGACGAAGCAGCGCATCGTCTTCGAGTCCGAAGAGCCAATC
ACTGGCGTCCAACTCGTGGCCGACGAGAAACTGACCACCCTCTTCGTTTCCACAACCTCTCGCATCATCAAGCTG
GGCCTCTCTAGGAAGGGTCAGGGACTGCCGCCCAAGACGGCTGAGGATGCCGGATGTGCCGTGGACTGCATGACT
TTGGATGACAACTCCGGCCAGGTGATTATCGCGCGCGAAGATGCCATCTACACTTACTCGGTCGACGGAAGAGGC
CCGCCTCGAGCCTACGAATCGCCCAAGAGTTTCATCGCCTTGTATCAAGGCTACGTTGCTCTGGCCTGTCCGTCT
TCGGGCTCGGGCGGGCGGGAGCCGGAAACTATGAGGCGCTTCGGCGGCGACGCCCTTCTAGAAGCCTCGTCATTT
GTCCTTTTAGACACAGATCTGCGCCTGATTGCTCATACCGAGACGCTCATCTCCCCCGTCCGATTCGTCTTTAGC
GTCTGGGGGATGCTTTTCACAATTGACCTCCAGGGAAAAGTCAATCAATACCGTGAGAAGGATCTGCAGCAGAGA
CTGGAAATGCTGTACCAAAGAAACATGTTCCCGCTCGCCATCGAGCTAGCCCAAAACTCGGGTCTCGATTTTAAG
CAGCAGAGCCTCATCTACCGCAAGTTCGGTGACCACCTCTACCAGAAAGGAGACTATGACGGTGCCATGGTGCAG
TACATTCGAGCCATCGATACGACTGAACCATCCCAGGTGATTCGCAAGTTCCTCGACACACAGCGCATACACAAC
CTCATCCAGTACCTAGAGCAGTTGCACGAACATAGAAAGGCCACGGCCGATCACACGACTCTATTGCTCAACTGC
TACGCCAAGCTAAAGGACATTGACAAGCTGGAGACGTTCATCAAGTCGCCCGGCGATCTCAAGTTCGACCTTGAC
ACGGCCATCGCCATGTGCCGCCAGGGCGGATACTACGAGCAGGCCGCCTATCTGGCCAAGAGACACGGCGAGACG
GAGCTCGTCGTCGACATTTTGATCGAAGACTCAAAGAGCTACGCAGAGGCGCTCAACTTCATCTGGCAACAGGAT
CCAGAGATTGCCTATCCCTGTCTTCAAAAGTATGCTCGAGTCCTCATTGAAAACTGTCCTCAGGATGCGACTCTA
CTCTTCGTGGAGTACTACACAGGCAGATACAAGCCCAGGCGCGAGGCGACGGTGGTGCAAGACGATAAGACGTCT
CAGACGGCCGGATTCGCCGCAAGCGCCGTTCAAAACCTGTCCAGCCTGCTTCCTTTTCCCTACATGACGAGCTCG
ACCCTCGCGAGCCCGGCGGCTGGCATCCTGCCGAGGGATCCCGTCGGCGAAGGGGCCGCAGAAGCAGCTGCAGCG
GCAACGGATGCCGTCGACGCCCGTGCGCCCGAGTACACGCCGCCTCCGCCTAGAACGGCCTTTTCATCCTTTATC
GATCACCCGGACGAGTTCATCAGCTTTCTCGAAGCGTGTCTGGAAGAGAAGTACGTCAGGTCGTCGGACAAGACG
GATCTCTATACGACGCTCTTTGAGATGTACCTACAAAAGTCGAGCGACAGCAAAGAGCAAGGCGACAAGTCCATG
TGGGAAGAAAAGGCCAAGAGGCTCATTGAGGGGGATCATGTGCCGATGGAGAGCTCCAACGTTCTCCTGCTGTCG
CATCTTTCCGACTTTAAACAGGGCACGGTCCTAGTCAAGGAGCAGGCCGGCTTGTTGTCGGACATTTTCCGATCC
TATACGTCGGCCAAGGACACGCGAGGTGCCATGAAGGCGCTGCGCAAGTACGGACCGGACGAGCCGCAGTTGTAC
CCGGAGGCGCTGGCATACTTGGCCTCGGATCCGCGGGTTCTCGACGAGGCGGGATCGGATGAGCTGGCTGGTATC
CTGTCCAAGATTGACAAGGACGGGCTCATGGCTCCATTGCAGGTTATCCAGACGCTCGTGGGGCAATCGACGGCC
GGCGGCGGCGTGGCGACGGTGGGCATGGTCAAACCATACTTGCACGAGACCATCACACGGGAACGAAAGGAGATT
GAAGCGAACCGTCACCGCATCGACACGCTACGAGCCGACACGGACAAGCGACGGGCCGAGCTATCAGAGCTTGGC
AGCAAGCCAGCCGTCTTCCAGGCAACGCGGTGCGCCGACTGCGGCCAGGGACTTGACCTCCCTGCGGTGCATTTC
CTCTGCAAGCACAGCTTCCATCAGCGTTGTCTGCGCGGCGGCGGCGGTGAGGAGGTGCAGATGGAGTGTCCCAAG
TGTTCGGGGGAGAATGCCGTGATACGCAAGATGAGGGAGGGGCAGCGGGAAACGGCGGAGAAGCACGAGCTTTTC
AAGGCTGATGTTGAGGCTAGCGATGATCGATTTGCGACTATGGCTGAGTGGTTCTCGAGGGGGGTTATGGATGCT
GGGAGAGATACGGAGCTGCCGCATGCGTAG
Gene >Ophcf2|03715
ATGGCCGTCTCAGTGCGTCAATCACGCTCCATCAGGTGCATTCAGCTAATTGTGTCTCACAGTGGAAGTCGTTTG
ACTTCTTCGAAGTCTCCAAAGTCACTCTCGCTGACGACGACGTCCGCCAGCTCTTCGAGAGCAGCGACATCTCCA
GTGTCTGCGCCGGTTCCGATAGTCTGTTCATCGGCTCTAATGATGGCTCCGTCAGCATCATCGGAAAGTCCTGGA
AGGTGATCCGCAAGTTCCAGGCCCACGATAACAGGCGGATCGCGCATATGCGCCAGGTCGAAGGCACCAGCATTC
TGGTCACTGTCGCTGTGAGTTGCAACCTCTAGCATTGTGCTGGAGGGTGGCGGCTCATAATATTATAGGAGGATC
TCAGTGGCGAGCCGGTTCTTAAGGCCTGGGCCCTAGACCAGCTCATCAAAAAGACCAACATGCCCACCTGTCTCA
GCACCCTGACCATTAACAATGGCAGGCGTCCATATCCAGTGCGATTTCTCCTCCCGAATGCGAGATAAACTGCTC
ATTATTCCCAAAGATAACCGCTCTGGCCGCCCTCGAAGACCTGTCACAGATTGCCGTCGGCTTTGGCAACGGCGC
CGTCACCGTGATCCGCGGCGACCTCATTCACGACCTTGGGACGAAGCAGCGCATCGTCTTCGAGTCCGAAGAGCC
AATCACTGGCGTCCAACTCGTGGCCGACGAGAAACTGACCACCCTCTTCGTTTCCACAACCTCTCGCATCATCAA
GCTGGGCCTCTCTAGGAAGGGTCAGGGACTGCCGCCCAAGACGGCTGAGGATGCCGGATGTGCCGTGGACTGCAT
GACTTTGGATGACAACTCCGGCCAGGTGATTATCGCGCGCGAAGATGCCATCTACACTTACTCGGTCGACGGAAG
AGGCCCGCCTCGAGCCTACGAATCGCCCAAGAGTTTCATCGCCTTGTATCAAGGCTACGTTGCTCTGGCCTGTCC
GTCTTCGGGCTCGGGCGGGCGGGAGCCGGAAACTATGAGGCGCTTCGGCGGCGACGCCCTTCTAGAAGCCTCGTC
ATTTGTCCTTTTAGACACAGATCTGCGCCTGATTGCTCATACCGAGACGCTCATCTCCCCCGTCCGATTCGTCTT
TAGCGTCTGGGGGATGCTTTTCACAATTGACCTCCAGGGAAAAGTGAGGAGATCCTCCGTGACCTCGTCGAGATT
GCTCTTGCTGACGTGCGCAGGTCAATCAATACCGTGAGAAGGATCTGCAGCAGAGACTGGAAATGCTGTACCAAA
GAAACATGTTCCCGCTCGCCATCGAGCTAGCCCAAAACTCGGGTCTCGATTTTAAGCAGCAGAGCCTCATCTACC
GCAAGTTCGGTGACCACCTCTACCAGAAAGGAGACTATGACGGTGCCATGGTGCAGTACATTCGAGCCATCGATA
CGACTGAACCATCCCAGGTGATTCGCAAGGTAAACCCTTGGTCAGCTGCGATGGCATCGAATGGCACTGATGGGT
ACCCAACAGTTCCTCGACACACAGCGCATACACAACCTCATCCAGTACCTAGAGCAGTTGCACGAACATAGAAAG
GCCACGGCCGATCACACGACTCTATTGCTCAACTGCTACGCCAAGCTAAAGGACATTGACAAGCTGGAGACGTTC
ATCAAGTCGCCCGGCGATCTCAAGTTCGACCTTGACACGGCCATCGCCATGTGCCGCCAGGGCGGATACTACGAG
CAGGCCGCCTATCTGGCCAAGAGACACGGCGAGACGGAGCTCGTCGTCGACATTTTGATCGAAGACTCAAAGAGC
TACGCAGAGGCGCTCAACTTCATCTGGCAACAGGATCCAGAGATTGTCTGTCATCCTCTTCGATCCCTCTCGTAG
TCCGGCTAACCGAGTCCAGGCCTATCCCTGTCTTCAAAAGTATGCTCGAGTCCTCATTGAAAACTGTCCTCAGGA
TGCGACTCTACTCTTCGTGGAGTACTACACAGGCAGATACAAGCCCAGGCGCGAGGCGACGGTGGTGCAAGACGA
TAAGACGTCTCAGACGGCCGGATTCGCCGCAAGCGCCGTTCAAAACCTGTCCAGCCTGCTTCCTTTTCCCTACAT
GACGAGCTCGACCCTCGCGAGCCCGGCGGCTGGCATCCTGCCGAGGGATCCCGTCGGCGAAGGGGCCGCAGAAGC
AGCTGCAGCGGCAACGGATGCCGTCGACGCCCGTGCGCCCGAGTACACGCCGCCTCCGCCTAGAACGGCCTTTTC
ATCCTTTATCGATCACCCGGACGAGTTCATCAGCTTTCTCGAAGCGTGTCTGGAAGAGAAGTACGTCAGGTCGTC
GGACAAGACGGATCTCTATACGACGCTCTTTGAGATGTACCTACAAAAGTCGAGCGACAGCAAAGAGCAAGGCGA
CAAGTCCATGTGGGAAGAAAAGGCCAAGAGGCTCATTGAGGGGGATCATGTGCCGATGGAGAGCTCCAACGTTCT
CCTGCTGTCGCATCTTTCCGACTTTAAACAGGGCACGGTCCTAGTCAAGGAGCAGGCCGGCTTGTTGTCGGACAT
TTTCCGATCCTATACGTCGGCCAAGGACACGCGAGGTGCCATGAAGGCGCTGCGCAAGTACGGACCGGACGAGCC
GCAGTTGTACCCGGAGGCGCTGGCATACTTGGCCTCGGATCCGCGGGTTCTCGACGAGGCGGGATCGGATGAGCT
GGCTGGTATCCTGTCCAAGATTGACAAGGACGGGCTCATGGCTCCATTGCAGGTTATCCAGACGCTCGTGGGGCA
ATCGACGGCCGGCGGCGGCGTGGCGACGGTGGGCATGGTCAAACCATACTTGCACGAGACCATCACACGGGAACG
AAAGGAGATTGAAGCGAACCGTCACCGCATCGACACGCTACGAGCCGACACGGACAAGCGACGGGCCGAGCTATC
AGAGCTTGGCAGCAAGCCAGCCGTCTTCCAGGCAACGCGGTGCGCCGACTGCGGCCAGGGACTTGACCTCCCTGC
GGTGCATTTCCTCTGCAAGCACAGCTTCCATCAGCGTTGTCTGCGCGGCGGCGGCGGTGAGGAGGTGCAGATGGA
GTGTCCCAAGTGTTCGGGGGAGAATGCCGTGATACGCAAGATGAGGGAGGGGCAGCGGGAAACGGCGGAGAAGCA
CGAGCTTTTCAAGGCTGATGTTGAGGCTAGCGATGATCGATTTGCGACTATGGCTGAGTGGTTCTCGAGGGGGGT
TATGGATGCTGGGAGAGATACGGAGCTGCCGCATGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail