Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03713
Gene name
Locationscaffold_03:3622185..3622953
Strand-
Gene length (bp)768
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04991 LicD LicD family 1.3E-15 98 193

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2317 0.1121 0.5414 0.1293 0.0941 0.1248 0.4822 0.3799 0.3278 0.0197

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.99941

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4813
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5410
Ophiocordyceps australis map64 (Brazil) OphauB2|3826
Ophiocordyceps camponoti-floridani Ophcf2|03713 (this protein)
Ophiocordyceps kimflemingae Ophio5|1260
Ophiocordyceps subramaniannii Hirsu2|10516

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03713
MARFGVMILTRLLVFSIFSLVSSTAIKHRTASSSSSSTSPPANKLPARPLTPKYFDEPRGSLARSHYDLRFFSSE
VDYQHHGSVLTGLIRSYLSVMDTHGVETWLAHGTLLGWWWNGRVMPWDYDLDVQVSNATLSWMAARLNQTRHLVG
GGEYLLDINPHFDEVDRGDGMNIIDARWIDVSNGMFIDITALREREQGLPGVWSCKNKHRYRTRDLWPMRVSQFE
GVAARVPYNVEKMLMDEYGAQCLVVEEHEG*
Coding >Ophcf2|03713
ATGGCGAGGTTTGGCGTCATGATCTTGACGAGGCTTCTCGTCTTCAGCATCTTCTCCCTCGTCAGCAGCACAGCC
ATTAAACACCGCACCGCCTCTTCCTCTTCCTCTTCCACTTCTCCTCCAGCCAACAAGCTCCCCGCCCGACCCTTG
ACGCCGAAATACTTTGACGAGCCGCGCGGAAGCCTAGCCCGCAGCCACTACGACCTCCGCTTCTTCAGCAGCGAA
GTCGACTACCAGCATCATGGCAGCGTCCTGACGGGCCTGATACGAAGCTACCTGTCCGTCATGGACACGCACGGG
GTGGAAACCTGGCTTGCGCACGGGACCTTGTTGGGTTGGTGGTGGAATGGGAGGGTGATGCCTTGGGATTACGAC
CTCGACGTTCAGGTTTCTAACGCGACGCTTTCGTGGATGGCGGCGAGGTTGAATCAGACGAGGCATCTGGTTGGG
GGGGGGGAATATCTCCTTGATATCAACCCTCATTTCGACGAGGTTGACCGGGGGGATGGGATGAACATCATTGAT
GCGAGGTGGATTGATGTTTCCAACGGCATGTTCATTGACATCACGGCCTTGAGGGAGAGGGAGCAAGGGTTGCCT
GGAGTGTGGAGCTGCAAAAACAAGCACCGTTATCGGACGAGGGATCTTTGGCCGATGAGGGTGAGTCAGTTTGAG
GGTGTGGCTGCGAGGGTACCGTACAACGTTGAGAAGATGTTGATGGATGAGTATGGGGCGCAGTGCTTGGTCGTT
GAGGAGCACGAGGGGTGA
Transcript >Ophcf2|03713
ATGGCGAGGTTTGGCGTCATGATCTTGACGAGGCTTCTCGTCTTCAGCATCTTCTCCCTCGTCAGCAGCACAGCC
ATTAAACACCGCACCGCCTCTTCCTCTTCCTCTTCCACTTCTCCTCCAGCCAACAAGCTCCCCGCCCGACCCTTG
ACGCCGAAATACTTTGACGAGCCGCGCGGAAGCCTAGCCCGCAGCCACTACGACCTCCGCTTCTTCAGCAGCGAA
GTCGACTACCAGCATCATGGCAGCGTCCTGACGGGCCTGATACGAAGCTACCTGTCCGTCATGGACACGCACGGG
GTGGAAACCTGGCTTGCGCACGGGACCTTGTTGGGTTGGTGGTGGAATGGGAGGGTGATGCCTTGGGATTACGAC
CTCGACGTTCAGGTTTCTAACGCGACGCTTTCGTGGATGGCGGCGAGGTTGAATCAGACGAGGCATCTGGTTGGG
GGGGGGGAATATCTCCTTGATATCAACCCTCATTTCGACGAGGTTGACCGGGGGGATGGGATGAACATCATTGAT
GCGAGGTGGATTGATGTTTCCAACGGCATGTTCATTGACATCACGGCCTTGAGGGAGAGGGAGCAAGGGTTGCCT
GGAGTGTGGAGCTGCAAAAACAAGCACCGTTATCGGACGAGGGATCTTTGGCCGATGAGGGTGAGTCAGTTTGAG
GGTGTGGCTGCGAGGGTACCGTACAACGTTGAGAAGATGTTGATGGATGAGTATGGGGCGCAGTGCTTGGTCGTT
GAGGAGCACGAGGGGTGA
Gene >Ophcf2|03713
ATGGCGAGGTTTGGCGTCATGATCTTGACGAGGCTTCTCGTCTTCAGCATCTTCTCCCTCGTCAGCAGCACAGCC
ATTAAACACCGCACCGCCTCTTCCTCTTCCTCTTCCACTTCTCCTCCAGCCAACAAGCTCCCCGCCCGACCCTTG
ACGCCGAAATACTTTGACGAGCCGCGCGGAAGCCTAGCCCGCAGCCACTACGACCTCCGCTTCTTCAGCAGCGAA
GTCGACTACCAGCATCATGGCAGCGTCCTGACGGGCCTGATACGAAGCTACCTGTCCGTCATGGACACGCACGGG
GTGGAAACCTGGCTTGCGCACGGGACCTTGTTGGGTTGGTGGTGGAATGGGAGGGTGATGCCTTGGGATTACGAC
CTCGACGTTCAGGTTTCTAACGCGACGCTTTCGTGGATGGCGGCGAGGTTGAATCAGACGAGGCATCTGGTTGGG
GGGGGGGAATATCTCCTTGATATCAACCCTCATTTCGACGAGGTTGACCGGGGGGATGGGATGAACATCATTGAT
GCGAGGTGGATTGATGTTTCCAACGGCATGTTCATTGACATCACGGCCTTGAGGGAGAGGGAGCAAGGGTTGCCT
GGAGTGTGGAGCTGCAAAAACAAGCACCGTTATCGGACGAGGGATCTTTGGCCGATGAGGGTGAGTCAGTTTGAG
GGTGTGGCTGCGAGGGTACCGTACAACGTTGAGAAGATGTTGATGGATGAGTATGGGGCGCAGTGCTTGGTCGTT
GAGGAGCACGAGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail