Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03708
Gene name
Locationscaffold_03:3609282..3610224
Strand-
Gene length (bp)942
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 162 184 22
2 197 219 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 11.41 3.69 19.12
Alive In ants, during behavior modification 64.91 34.59 95.22
Dead In ants, recently dead 29.32 13.18 45.46

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03708
MNAGQRVSDSTGPLMFARSLVLSVERGSGLARSSRLARPPKLAGERISMLTGPLMLAGSLVLSGERESGLARPLM
FARSLMLAGEWVSGLAGHLMLTRPLMLAVSFMLSGEGESGFTRPFMLAVSFMLSGKRVSGFTVPLILAVSLMLSE
ERESGLTRLFMLAVSFVLAESFMLAVPLLLAVLLMPVESFMLARKRVSGLTVPLVLAVPVMLVVPLVLAEERITV
LIRSSRLARPLRERKLVLTRPSNLARERRTGLARYSRLTYSLRLAWHPGLTRFLRLAVSLMLAGGRVSGPG*
Coding >Ophcf2|03708
ATGAACGCCGGGCAACGGGTATCCGACTCTACCGGGCCTCTCATGTTCGCCAGGTCTCTCGTGCTCTCCGTGGAA
AGGGGATCCGGGCTCGCGCGGTCTTCCAGGCTCGCTCGGCCTCCGAAGCTCGCCGGGGAACGGATCTCCATGCTG
ACCGGGCCTCTCATGCTCGCCGGATCTCTCGTTCTCTCCGGGGAAAGGGAATCCGGGCTCGCGCGGCCTCTCATG
TTCGCCAGGTCTCTGATGCTCGCCGGGGAATGGGTATCCGGGCTCGCCGGGCATCTCATGCTTACCAGGCCTCTC
ATGCTCGCTGTGTCTTTCATGCTCTCCGGGGAAGGGGAATCCGGGTTCACGCGACCTTTCATGCTCGCCGTATCT
TTCATGCTCTCCGGGAAACGGGTATCCGGGTTCACCGTGCCTCTCATTCTCGCCGTGTCTCTCATGCTCTCCGAG
GAAAGGGAATCCGGGCTCACGCGGCTTTTCATGCTCGCCGTGTCTTTCGTGCTCGCCGAATCTTTCATGCTCGCC
GTGCCTCTCCTGCTCGCCGTGCTTCTCATGCCCGTCGAATCTTTCATGCTCGCCAGGAAACGGGTATCCGGGCTC
ACCGTGCCTCTCGTGCTCGCCGTGCCTGTCATGCTCGTCGTGCCTCTCGTGCTCGCCGAGGAGAGGATAACCGTG
CTCATTAGGTCTTCCAGGCTCGCCAGACCTCTCAGGGAAAGGAAGCTTGTGCTCACCCGGCCGTCCAACCTCGCC
AGAGAACGGAGAACCGGACTCGCCCGTTATTCCAGACTCACCTACTCTCTCAGGCTCGCCTGGCATCCCGGACTC
ACCCGATTTCTCAGGCTGGCCGTGTCTCTCATGCTGGCCGGGGGACGGGTGTCCGGGCCTGGCTGA
Transcript >Ophcf2|03708
ATGAACGCCGGGCAACGGGTATCCGACTCTACCGGGCCTCTCATGTTCGCCAGGTCTCTCGTGCTCTCCGTGGAA
AGGGGATCCGGGCTCGCGCGGTCTTCCAGGCTCGCTCGGCCTCCGAAGCTCGCCGGGGAACGGATCTCCATGCTG
ACCGGGCCTCTCATGCTCGCCGGATCTCTCGTTCTCTCCGGGGAAAGGGAATCCGGGCTCGCGCGGCCTCTCATG
TTCGCCAGGTCTCTGATGCTCGCCGGGGAATGGGTATCCGGGCTCGCCGGGCATCTCATGCTTACCAGGCCTCTC
ATGCTCGCTGTGTCTTTCATGCTCTCCGGGGAAGGGGAATCCGGGTTCACGCGACCTTTCATGCTCGCCGTATCT
TTCATGCTCTCCGGGAAACGGGTATCCGGGTTCACCGTGCCTCTCATTCTCGCCGTGTCTCTCATGCTCTCCGAG
GAAAGGGAATCCGGGCTCACGCGGCTTTTCATGCTCGCCGTGTCTTTCGTGCTCGCCGAATCTTTCATGCTCGCC
GTGCCTCTCCTGCTCGCCGTGCTTCTCATGCCCGTCGAATCTTTCATGCTCGCCAGGAAACGGGTATCCGGGCTC
ACCGTGCCTCTCGTGCTCGCCGTGCCTGTCATGCTCGTCGTGCCTCTCGTGCTCGCCGAGGAGAGGATAACCGTG
CTCATTAGGTCTTCCAGGCTCGCCAGACCTCTCAGGGAAAGGAAGCTTGTGCTCACCCGGCCGTCCAACCTCGCC
AGAGAACGGAGAACCGGACTCGCCCGTTATTCCAGACTCACCTACTCTCTCAGGCTCGCCTGGCATCCCGGACTC
ACCCGATTTCTCAGGCTGGCCGTGTCTCTCATGCTGGCCGGGGGACGGGTGTCCGGGCCTGGCTGA
Gene >Ophcf2|03708
ATGAACGCCGGGCAACGGGTATCCGACTCTACCGGGCCTCTCATGTTCGCCAGGTCTCTCGTGCTCTCCGTGGAA
AGGGGATCCGGGCTCGCGCGGTCTTCCAGGCTCGCTCGGCCTCCGAAGCTCGCCGGGGAACGGATCTCCATGCTG
ACCGGGCCTCTCATGCTCGCCGGATCTCTCGTTCTCTCCGGGGAAAGGGAATCCGGGCTCGCGCGGCCTCTCATG
TTCGCCAGGTCTCTGATGCTCGCCGGGGAATGGGTATCCGGGCTCGCCGGGCATCTCATGCTTACCAGGCCTCTC
ATGCTCGCTGTGTCTTTCATGCTCTCCGGGGAAGGGGAATCCGGGTTCACGCGACCTTTCATGCTCGCCGTATCT
TTCATGCTCTCCGGGAAACGGGTATCCGGGTTCACCGTGCCTCTCATTCTCGCCGTGTCTCTCATGCTCTCCGAG
GAAAGGGAATCCGGGCTCACGCGGCTTTTCATGCTCGCCGTGTCTTTCGTGCTCGCCGAATCTTTCATGCTCGCC
GTGCCTCTCCTGCTCGCCGTGCTTCTCATGCCCGTCGAATCTTTCATGCTCGCCAGGAAACGGGTATCCGGGCTC
ACCGTGCCTCTCGTGCTCGCCGTGCCTGTCATGCTCGTCGTGCCTCTCGTGCTCGCCGAGGAGAGGATAACCGTG
CTCATTAGGTCTTCCAGGCTCGCCAGACCTCTCAGGTTCGCTAGGAAAGGGAGATTCGGGCTGACCCGGCCGTCT
ATGCTCGCTAGGGAAAGGAAGCTTGTGCTCACCCGGCCGTCCAACCTCGCCAGAGAACGGAGAACCGGACTCGCC
CGTTATTCCAGACTCACCTACTCTCTCAGGCTCGCCTGGCATCCCGGACTCACCCGATTTCTCAGGCTGGCCGTG
TCTCTCATGCTGGCCGGGGGACGGGTGTCCGGGCCTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail