Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03707
Gene name
Locationscaffold_03:3605211..3608345
Strand+
Gene length (bp)3134
Transcript length (bp)3087
Coding sequence length (bp)3087
Protein length (aa) 1029

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1911 0.1939 0.9405 0.0769 0.1035 0.0509 0.2089 0.1481 0.1342 0.0363

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999662

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1268
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|299
Ophiocordyceps australis map64 (Brazil) OphauB2|2413
Ophiocordyceps camponoti-floridani Ophcf2|03707 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4177
Ophiocordyceps kimflemingae Ophio5|1254
Ophiocordyceps subramaniannii Hirsu2|10523

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03707
MKAIVVSVLAAGVANGFKSTDCDDDNCYGSLINERFKNHAPGFCADFISGVKTDPANIHADFRVNCDNDVGKVSS
ACSCVAHAATPTGNVPGATGSDDSAGWMPTETSSPDSNSGMGSDNSSPEASTTGAALNPRSAGDTWNSRISDQML
SAAHRPSQVLPALHASGSMVPVHVRGRASPTRVGVAGSRRRPALSSLPDDGDDDILDGDGEFGGEAGFSGYGGGN
YRGGGFRGDDGFIGFGDDDDVGLSGNHWQGSGSPITGGPSYRRPGSISRSGHSVGRHESGLDVGFDESGLDLGLH
GADSGFGLHGSNSDSDFGPDLDFGPDLDFGPDLDFGPHRSDIDFDSDLDHDFGFDGSGRRVGIHGAGRRVGLQRS
GAGVGRYGSGAGHRLHGPGSRPAFGLHGSSPGPNLGLERVGSDPNSDSDFDLGLEGSRPDLGVHDSSHGSRRHRS
GAGVGVYGSGPGLGHHRVGSNPNSDPDFDSDFDLGLDGTSPGLGIHDSGYGSRRYSSKAGVGVYGSGPGLGLHRS
NSDLDSDPDLDSDPDLDLGLDGSSSGLGIHESGRGSVHRMPNAGVRLHRSGAGLGLHGSVPAPEIESDLDLEPDG
SAPGLRFHGSRYGVGHDRPGAGFRLHGSGSDPDFGSDVRAGFGDGIDIDEDSDMGSDLDSGIGQGFGIGFGSGSG
SGSGSGSGSVPGSRSSRTSQSFGFPDLTNLLPGLSGLTNQLHPFQSPDSQASSPTSNLPEAATRVPDSPVSAPDG
DLPPPAEIRFSLPPGFQPPSSSNQGSSSFQAKFPGASTTPTASETGYWLSSDATGSSDSVSATDAFGGYPSSAPS
SSASNGVQSSSPSASISVGYWAPTTASDPSATESGTQTSDLSTTASSPSVPSLFDYPLISLRHPDGNSTSLSLNN
LWFSDRVPTGSSSAAQSDVSTGPGSPSVDPVVPSASLFPSTQNTPEQNPTSLQRVSAPSQANISPPEETRGSDPT
WTAVIWPPWCAIVQPIWISVLWQAISQGARVSFPHGIWKAASWRAGAPFPWRA*
Coding >Ophcf2|03707
ATGAAAGCCATCGTCGTCAGCGTTTTGGCCGCTGGTGTCGCCAACGGCTTCAAATCCACGGACTGCGATGATGAC
AACTGCTACGGCAGCCTCATCAACGAACGCTTCAAAAACCATGCCCCCGGCTTCTGCGCCGACTTCATCTCAGGC
GTCAAGACGGACCCGGCCAACATCCACGCCGATTTCCGCGTCAACTGCGACAACGACGTGGGAAAAGTCAGCTCC
GCCTGCTCCTGTGTCGCCCACGCGGCTACCCCTACTGGAAATGTTCCCGGGGCCACCGGTTCCGATGACTCTGCT
GGCTGGATGCCGACGGAGACGTCGTCTCCTGACTCCAACTCCGGCATGGGCTCTGACAACAGCTCGCCCGAAGCC
TCGACCACGGGAGCTGCTCTGAACCCTCGATCCGCTGGCGATACCTGGAACTCTCGAATTAGCGACCAGATGCTC
AGTGCCGCCCATAGGCCATCTCAAGTGCTGCCTGCTCTTCACGCTTCTGGCTCTATGGTCCCGGTCCATGTACGC
GGAAGAGCCAGCCCGACCAGGGTGGGCGTCGCCGGTTCCCGCCGTCGTCCCGCCCTTTCCAGTCTTCCCGATGAC
GGCGATGACGATATTCTCGACGGCGACGGCGAATTTGGGGGCGAAGCCGGCTTCAGCGGCTACGGGGGCGGCAAC
TACAGGGGCGGCGGCTTCAGGGGCGATGACGGCTTCATCGGCTTCGGGGACGACGACGACGTCGGCCTTTCCGGC
AACCACTGGCAAGGCTCAGGCTCCCCAATTACGGGCGGACCCTCCTACAGAAGGCCTGGCTCGATCTCTCGCTCT
GGCCACAGCGTTGGGCGACACGAGTCTGGCCTTGACGTTGGGTTTGATGAGTCTGGCCTTGACCTTGGGCTCCAC
GGGGCTGACTCCGGCTTTGGGCTTCATGGCTCTAACTCCGACTCTGACTTTGGGCCCGACCTCGACTTTGGGCCC
GACCTCGACTTTGGGCCCGACCTCGACTTTGGGCCTCATAGGTCTGACATCGACTTTGACTCTGACCTTGACCAT
GACTTTGGGTTTGATGGGTCTGGCCGCCGTGTTGGGATTCATGGAGCCGGCCGTCGTGTTGGGCTTCAACGGTCT
GGCGCTGGAGTTGGACGTTATGGCTCTGGTGCCGGTCATAGGCTTCACGGTCCTGGCTCTAGACCCGCCTTTGGA
CTTCACGGCTCTAGTCCTGGCCCCAACCTTGGACTTGAAAGGGTCGGCTCTGACCCTAACTCTGACTCCGACTTC
GACCTCGGGCTGGAAGGATCTCGGCCCGATCTCGGGGTTCATGACTCCAGCCACGGCTCTAGGCGTCACAGGTCC
GGAGCCGGCGTTGGAGTTTACGGATCTGGCCCCGGCCTCGGACATCACAGGGTCGGTTCTAATCCTAACTCTGAC
CCGGACTTCGACTCCGACTTCGACCTCGGGCTAGATGGAACTAGCCCCGGTCTCGGAATTCATGATTCTGGCTAC
GGCTCTAGGCGTTACAGTTCCAAGGCCGGCGTTGGAGTATACGGATCTGGCCCCGGTCTTGGGCTTCATAGGTCT
AACTCTGACCTCGACTCTGACCCCGACCTCGACTCTGACCCCGACCTCGACCTCGGGCTTGATGGATCTAGCTCC
GGTCTCGGGATTCATGAGTCTGGCCGCGGCTCTGTGCATCGTATGCCCAATGCCGGCGTTAGACTTCATAGGTCT
GGTGCCGGTCTTGGGCTTCACGGCTCAGTCCCAGCCCCTGAGATTGAGTCTGACCTTGACCTTGAGCCTGATGGT
TCTGCCCCAGGTCTTAGGTTTCACGGATCTCGCTACGGCGTCGGACATGACAGACCTGGCGCCGGCTTTAGGCTT
CATGGATCTGGCTCTGACCCTGATTTTGGCTCTGACGTGCGCGCCGGCTTTGGCGATGGCATTGACATTGACGAG
GACTCTGACATGGGCTCAGACTTGGACTCTGGCATTGGCCAGGGCTTCGGCATTGGTTTCGGTTCCGGTTCCGGT
TCCGGTTCCGGCTCCGGCTCCGGCTCCGTACCGGGCTCCCGCTCCTCCCGCACTAGCCAGTCATTCGGCTTCCCC
GACTTGACCAACCTGCTTCCAGGGCTATCAGGGCTAACCAATCAGCTGCATCCGTTCCAAAGCCCCGACTCTCAA
GCGAGCTCTCCTACCTCGAACTTACCCGAAGCTGCCACTCGAGTCCCCGACTCTCCGGTCTCGGCTCCGGACGGC
GATCTTCCGCCTCCAGCCGAGATCCGATTCTCCCTTCCTCCGGGATTCCAGCCTCCCTCTTCGTCCAACCAAGGT
TCTTCCTCGTTCCAGGCCAAGTTCCCTGGGGCTTCAACCACACCGACTGCTTCTGAGACTGGTTACTGGCTGTCT
TCTGACGCCACAGGCTCGAGTGACAGCGTCTCGGCTACCGACGCATTCGGAGGCTACCCATCGTCGGCCCCGTCA
TCGTCTGCCAGCAACGGAGTCCAGTCTTCGAGCCCGTCTGCGTCTATAAGCGTCGGGTATTGGGCTCCGACTACA
GCTAGCGATCCATCGGCCACCGAGTCTGGAACGCAAACATCCGACCTTTCTACAACTGCCTCCTCGCCCTCTGTC
CCCAGCTTGTTCGACTATCCTTTAATCTCGCTCCGTCATCCGGACGGGAACTCGACGTCACTGTCGCTTAACAAT
CTATGGTTCAGCGACCGCGTACCGACAGGCTCGTCGTCTGCCGCTCAGTCAGATGTTTCGACCGGACCTGGATCG
CCATCGGTTGACCCCGTCGTCCCGTCGGCTTCTCTGTTCCCTTCGACTCAAAACACGCCTGAGCAAAACCCGACC
TCTCTGCAGCGCGTATCGGCTCCTAGCCAGGCCAATATCAGCCCTCCTGAAGAAACTCGAGGCAGCGATCCCACC
TGGACGGCCGTTATCTGGCCCCCCTGGTGCGCCATCGTTCAACCGATCTGGATATCCGTTCTCTGGCAGGCCATC
AGCCAGGGAGCCAGGGTATCCTTTCCCCATGGGATCTGGAAAGCCGCGAGCTGGCGAGCCGGAGCACCCTTTCCC
TGGCGAGCCTAA
Transcript >Ophcf2|03707
ATGAAAGCCATCGTCGTCAGCGTTTTGGCCGCTGGTGTCGCCAACGGCTTCAAATCCACGGACTGCGATGATGAC
AACTGCTACGGCAGCCTCATCAACGAACGCTTCAAAAACCATGCCCCCGGCTTCTGCGCCGACTTCATCTCAGGC
GTCAAGACGGACCCGGCCAACATCCACGCCGATTTCCGCGTCAACTGCGACAACGACGTGGGAAAAGTCAGCTCC
GCCTGCTCCTGTGTCGCCCACGCGGCTACCCCTACTGGAAATGTTCCCGGGGCCACCGGTTCCGATGACTCTGCT
GGCTGGATGCCGACGGAGACGTCGTCTCCTGACTCCAACTCCGGCATGGGCTCTGACAACAGCTCGCCCGAAGCC
TCGACCACGGGAGCTGCTCTGAACCCTCGATCCGCTGGCGATACCTGGAACTCTCGAATTAGCGACCAGATGCTC
AGTGCCGCCCATAGGCCATCTCAAGTGCTGCCTGCTCTTCACGCTTCTGGCTCTATGGTCCCGGTCCATGTACGC
GGAAGAGCCAGCCCGACCAGGGTGGGCGTCGCCGGTTCCCGCCGTCGTCCCGCCCTTTCCAGTCTTCCCGATGAC
GGCGATGACGATATTCTCGACGGCGACGGCGAATTTGGGGGCGAAGCCGGCTTCAGCGGCTACGGGGGCGGCAAC
TACAGGGGCGGCGGCTTCAGGGGCGATGACGGCTTCATCGGCTTCGGGGACGACGACGACGTCGGCCTTTCCGGC
AACCACTGGCAAGGCTCAGGCTCCCCAATTACGGGCGGACCCTCCTACAGAAGGCCTGGCTCGATCTCTCGCTCT
GGCCACAGCGTTGGGCGACACGAGTCTGGCCTTGACGTTGGGTTTGATGAGTCTGGCCTTGACCTTGGGCTCCAC
GGGGCTGACTCCGGCTTTGGGCTTCATGGCTCTAACTCCGACTCTGACTTTGGGCCCGACCTCGACTTTGGGCCC
GACCTCGACTTTGGGCCCGACCTCGACTTTGGGCCTCATAGGTCTGACATCGACTTTGACTCTGACCTTGACCAT
GACTTTGGGTTTGATGGGTCTGGCCGCCGTGTTGGGATTCATGGAGCCGGCCGTCGTGTTGGGCTTCAACGGTCT
GGCGCTGGAGTTGGACGTTATGGCTCTGGTGCCGGTCATAGGCTTCACGGTCCTGGCTCTAGACCCGCCTTTGGA
CTTCACGGCTCTAGTCCTGGCCCCAACCTTGGACTTGAAAGGGTCGGCTCTGACCCTAACTCTGACTCCGACTTC
GACCTCGGGCTGGAAGGATCTCGGCCCGATCTCGGGGTTCATGACTCCAGCCACGGCTCTAGGCGTCACAGGTCC
GGAGCCGGCGTTGGAGTTTACGGATCTGGCCCCGGCCTCGGACATCACAGGGTCGGTTCTAATCCTAACTCTGAC
CCGGACTTCGACTCCGACTTCGACCTCGGGCTAGATGGAACTAGCCCCGGTCTCGGAATTCATGATTCTGGCTAC
GGCTCTAGGCGTTACAGTTCCAAGGCCGGCGTTGGAGTATACGGATCTGGCCCCGGTCTTGGGCTTCATAGGTCT
AACTCTGACCTCGACTCTGACCCCGACCTCGACTCTGACCCCGACCTCGACCTCGGGCTTGATGGATCTAGCTCC
GGTCTCGGGATTCATGAGTCTGGCCGCGGCTCTGTGCATCGTATGCCCAATGCCGGCGTTAGACTTCATAGGTCT
GGTGCCGGTCTTGGGCTTCACGGCTCAGTCCCAGCCCCTGAGATTGAGTCTGACCTTGACCTTGAGCCTGATGGT
TCTGCCCCAGGTCTTAGGTTTCACGGATCTCGCTACGGCGTCGGACATGACAGACCTGGCGCCGGCTTTAGGCTT
CATGGATCTGGCTCTGACCCTGATTTTGGCTCTGACGTGCGCGCCGGCTTTGGCGATGGCATTGACATTGACGAG
GACTCTGACATGGGCTCAGACTTGGACTCTGGCATTGGCCAGGGCTTCGGCATTGGTTTCGGTTCCGGTTCCGGT
TCCGGTTCCGGCTCCGGCTCCGGCTCCGTACCGGGCTCCCGCTCCTCCCGCACTAGCCAGTCATTCGGCTTCCCC
GACTTGACCAACCTGCTTCCAGGGCTATCAGGGCTAACCAATCAGCTGCATCCGTTCCAAAGCCCCGACTCTCAA
GCGAGCTCTCCTACCTCGAACTTACCCGAAGCTGCCACTCGAGTCCCCGACTCTCCGGTCTCGGCTCCGGACGGC
GATCTTCCGCCTCCAGCCGAGATCCGATTCTCCCTTCCTCCGGGATTCCAGCCTCCCTCTTCGTCCAACCAAGGT
TCTTCCTCGTTCCAGGCCAAGTTCCCTGGGGCTTCAACCACACCGACTGCTTCTGAGACTGGTTACTGGCTGTCT
TCTGACGCCACAGGCTCGAGTGACAGCGTCTCGGCTACCGACGCATTCGGAGGCTACCCATCGTCGGCCCCGTCA
TCGTCTGCCAGCAACGGAGTCCAGTCTTCGAGCCCGTCTGCGTCTATAAGCGTCGGGTATTGGGCTCCGACTACA
GCTAGCGATCCATCGGCCACCGAGTCTGGAACGCAAACATCCGACCTTTCTACAACTGCCTCCTCGCCCTCTGTC
CCCAGCTTGTTCGACTATCCTTTAATCTCGCTCCGTCATCCGGACGGGAACTCGACGTCACTGTCGCTTAACAAT
CTATGGTTCAGCGACCGCGTACCGACAGGCTCGTCGTCTGCCGCTCAGTCAGATGTTTCGACCGGACCTGGATCG
CCATCGGTTGACCCCGTCGTCCCGTCGGCTTCTCTGTTCCCTTCGACTCAAAACACGCCTGAGCAAAACCCGACC
TCTCTGCAGCGCGTATCGGCTCCTAGCCAGGCCAATATCAGCCCTCCTGAAGAAACTCGAGGCAGCGATCCCACC
TGGACGGCCGTTATCTGGCCCCCCTGGTGCGCCATCGTTCAACCGATCTGGATATCCGTTCTCTGGCAGGCCATC
AGCCAGGGAGCCAGGGTATCCTTTCCCCATGGGATCTGGAAAGCCGCGAGCTGGCGAGCCGGAGCACCCTTTCCC
TGGCGAGCCTAA
Gene >Ophcf2|03707
ATGAAAGCCATCGTCGTCAGCGTTTTGGCCGCTGGTGTCGCCAACGGCTTCAAATCCACGGACTGCGATGATGAC
AACTGCTACGGCAGCCTCATCAACGAACGCTTCAAAAACCATGCCCCCGGCTTCTGCGCCGACTTCATCTCAGGC
GTCAAGACGGACCCGGCCAACATCCACGCCGATTTCCGCGTCAACTGCGACAACGACGTGGGAAAAGTCAGCTCC
GCCTGCTCCTGTGTCGCCCACGCGGCTACCCCTACTGGAAATGTTCCCGGGGCCACCGGTTCCGATGACTCTGCT
GGCTGGATGCCGACGGAGACGTCGTCTCCTGACTCCAACTCCGGCATGGGCTCTGACAACAGCTCGCCCGAAGCC
TCGACCACGGGAGCTGCTCTGAACCCTCGATCCGCTGGCGATACCTGGAACTCTCGAATTAGCGACCAGATGCTC
AGTGCCGCCCATAGGCCATCTCAAGTGCTGCCTGCTCTTCACGCTTCTGGCTCTATGGTCCCGGTCCATGTACGC
GGAAGAGCCAGCCCGACCAGGGTGGGCGTCGCCGGTTCCCGCCGTCGTCCCGCCCTTTCCAGTCTTCCCGATGAC
GGCGATGACGATATTCTCGACGGCGACGGCGAATTTGGGGGCGAAGCCGGCTTCAGCGGCTACGGGGGCGGCAAC
TACAGGGGCGGCGGCTTCAGGGGCGATGACGGCTTCATCGGCTTCGGGGACGACGACGACGTCGGCCTTTCCGGC
AACCACTGGCAAGGCTCAGGCTCCCCAATTACGGGCGGACCCTCCTACAGAAGGCCTGGCTCGATCTCTCGCTCT
GGCCACAGCGTTGGGCGACACGAGTCTGGCCTTGACGTTGGGTTTGATGAGTCTGGCCTTGACCTTGGGCTCCAC
GGGGCTGACTCCGGCTTTGGGCTTCATGGCTCTAACTCCGACTCTGACTTTGGGCCCGACCTCGACTTTGGGCCC
GACCTCGACTTTGGGCCCGACCTCGACTTTGGGCCTCATAGGTCTGACATCGACTTTGACTCTGACCTTGACCAT
GACTTTGGGTTTGATGGGTCTGGCCGCCGTGTTGGGATTCATGGAGCCGGCCGTCGTGTTGGGCTTCAACGGTCT
GGCGCTGGAGTTGGACGTTATGGCTCTGGTGCCGGTCATAGGCTTCACGGTCCTGGCTCTAGACCCGCCTTTGGA
CTTCACGGCTCTAGTCCTGGCCCCAACCTTGGACTTGAAAGGGTCGGCTCTGACCCTAACTCTGACTCCGACTTC
GACCTCGGGCTGGAAGGATCTCGGCCCGATCTCGGGGTTCATGACTCCAGCCACGGCTCTAGGCGTCACAGGTCC
GGAGCCGGCGTTGGAGTTTACGGATCTGGCCCCGGCCTCGGACATCACAGGGTCGGTTCTAATCCTAACTCTGAC
CCGGACTTCGACTCCGACTTCGACCTCGGGCTAGATGGAACTAGCCCCGGTCTCGGAATTCATGATTCTGGCTAC
GGCTCTAGGCGTTACAGTTCCAAGGCCGGCGTTGGAGTATACGGATCTGGCCCCGGTCTTGGGCTTCATAGGTCT
AACTCTGACCTCGACTCTGACCCCGACCTCGACTCTGACCCCGACCTCGACCTCGGGCTTGATGGATCTAGCTCC
GGTCTCGGGATTCATGAGTCTGGCCGCGGCTCTGTGCATCGTATGCCCAATGCCGGCGTTAGACTTCATAGGTCT
GGTGCCGGTCTTGGGCTTCACGGCTCAGTCCCAGCCCCTGAGATTGAGTCTGACCTTGACCTTGAGCCTGATGGT
TCTGCCCCAGGTCTTAGGTTTCACGGATCTCGCTACGGCGTCGGACATGACAGACCTGGCGCCGGCTTTAGGCTT
CATGGATCTGGCTCTGACCCTGATTTTGGCTCTGACGTGCGCGCCGGCTTTGGCGATGGCATTGACATTGACGAG
GACTCTGACATGGGCTCAGACTTGGACTCTGGCATTGGCCAGGGCTTCGGCATTGGTTTCGGTTCCGGTTCCGGT
TCCGGTTCCGGCTCCGGCTCCGGCTCCGTACCGGGCTCCCGCTCCTCCCGCACTAGCCAGTCATTCGGCTTCCCC
GACTTGACCAACCTGCTTCCAGGGCTATCAGGGCTAACCAATCAGCTGCATCCGTTCCAAAGCCCCGACTCTCAA
GCGAGCTCTCCTACCTCGAACTTACCCGAAGCTGCCACTCGAGTCCCCGACTCTCCGGTCTCGGCTCCGGACGGC
GATCTTCCGCCTCCAGCCGAGATCCGATTCTCCCTTCCTCCGGGATTCCAGCCTCCCTCTTCGTCCAACCAAGGT
TCTTCCTCGTTCCAGGCCAAGTTCCCTGGGGCTTCAACCACACCGACTGCTTCTGAGACTGGTTACTGGCTGTCT
TCTGACGCCACAGGCTCGAGTGACAGCGTCTCGGCTACCGACGCATTCGGAGGCTACCCATCGTCGGCCCCGTCA
TCGTCTGCCAGCAACGGAGTCCAGTCTTCGAGCCCGTCTGCGTCTATAAGCGTCGGGTATTGGGCTCCGACTACA
GCTAGCGATCCATCGGCCACCGAGTCTGGAACGCAAACATCCGACCTTTCTACAACTGCCTCCTCGCCCTCTGTC
CCCAGCTTGTTCGACTATCCTTTAATCTCGCTCCGTCATCCGGACGGGAACTCGACGTCACTGTCGCTTAACAAT
CTATGGTTCAGCGACCGCGTACCGACAGGCTCGTCGTCTGCCGCTCAGTCAGATGTTTCGACCGGACCTGGATCG
CCATCGGTTGACCCCGTCGTCCCGTCGGCTTCTCTGTTCCCTTCGACTCAAAACACGCCTGAGCAAAACCCGACC
TCTCTGCAGCGCGTATCGGCTCCTAGCCAGGCCAATATCAGCCCTCCTGAAGAAACTCGAGGCAGCGATCCCAGT
GAGATATCCGTCGCCAGACGACCTGAGCTACCATTCTCACGCCAGCCTGGACGGCCGTTATCTGGCCCCCCTGGT
GCGCCATCGTTCAACCGATCTGGATATCCGTTCTCTGGCAGGCCATCAGCCAGGGAGCCAGGGTATCCTTTCCCC
ATGGGATCTGGAAAGCCGCGAGCTGGCGAGCCGGAGCACCCTTTCCCTGGCGAGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail