Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03700
Gene name
Locationscaffold_03:3580348..3582165
Strand-
Gene length (bp)1817
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04189 Gcd10p Gcd10p family 1.1E-110 43 411

GO

GO Term Description Terminal node
GO:0031515 tRNA (m1A) methyltransferase complex Yes
GO:0030488 tRNA methylation Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0032991 protein-containing complex No
GO:1990234 transferase complex No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008033 tRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0043414 macromolecule methylation No
GO:0032259 methylation No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0006399 tRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0043527 tRNA methyltransferase complex No
GO:0016070 RNA metabolic process No
GO:0006400 tRNA modification No
GO:0090304 nucleic acid metabolic process No
GO:0034470 ncRNA processing No
GO:0043412 macromolecule modification No
GO:0034708 methyltransferase complex No
GO:0009451 RNA modification No
GO:0008150 biological_process No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0001510 RNA methylation No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.283 0.9125 0.1543 0.035 0.2686 0.0078 0.0754 0.0183 0.0228 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6225
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2785
Ophiocordyceps australis map64 (Brazil) OphauB2|2823
Ophiocordyceps camponoti-floridani Ophcf2|03700 (this protein)
Ophiocordyceps kimflemingae Ophio5|5774
Ophiocordyceps subramaniannii Hirsu2|704

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03700
MMLARGGLAARDPLQGITLVNLQKPDAHHGTKRKPLMAARNSIQPHGWAALKLPNETLRVLQVTPNTTISLGKYG
SFPSNLLIERPFHLTYEVSERREGESFSRLRIVPGTELNADLLAADNDDLDESALVDEAACRLGPPDEDDDPGGS
RRQTLTTAEIEDLKRRGADAGKELIAKLMLSHTALDQKSAFSLAKYRLLKEKKFLRRFTVLPVDVPLLARWMLEV
REPAKILDMRLELIGLVSSWADVHFGGADGRWLAVDDTGGLLVAAMAESMGILHRHPATETDGKEGKEDGHDEVE
PVDSRATDETSPDNRPTKLAHLRKRPRRDDLDDHYAPGNTITLLHANSQPNLSLLRYFDYDASDPNPPAPHHPLF
THLLSLSWLQLVSPESDPAYAERPADVPAEELAAWKPNRRGNYFRKRRRWARTRQVVEGARAGGFSGLAVASAMD
PISVLRHALPLLSGGSPIAVYSPHIEPLTKLADCFTIARRAAWLSSPPADAEGRTQAELERWTGTAEFPLNPTLV
LGATVHTSRAKRWQVLPGRTHPYMTARGGSDGYVFTGWRAIPAEGRVSARGKFQKKKACGG*
Coding >Ophcf2|03700
ATGATGCTCGCTCGCGGTGGACTGGCAGCACGTGACCCTCTGCAGGGCATAACCCTGGTCAACCTTCAGAAGCCC
GACGCCCATCACGGAACCAAAAGAAAGCCGCTGATGGCCGCTCGCAACTCGATCCAGCCCCATGGCTGGGCGGCG
CTAAAGCTCCCCAACGAGACACTGCGCGTGCTACAGGTGACGCCCAATACAACCATCTCCCTCGGCAAATACGGC
TCCTTCCCGAGCAACCTGCTGATAGAGCGGCCCTTTCACCTGACGTACGAAGTCTCGGAGCGTCGAGAAGGAGAG
TCCTTTTCACGACTGCGCATCGTTCCGGGCACGGAGCTCAACGCCGACCTCTTGGCCGCCGACAACGATGACTTG
GACGAATCGGCGCTGGTGGACGAAGCTGCTTGTCGCCTGGGGCCGCCGGACGAAGACGACGACCCGGGCGGTTCA
AGGCGGCAGACGCTGACGACGGCCGAGATCGAGGACCTCAAGCGACGGGGCGCCGACGCGGGAAAGGAGCTCATC
GCCAAACTCATGCTTTCCCACACGGCTCTCGATCAAAAGTCTGCCTTTTCGCTGGCCAAGTATCGGCTTCTCAAG
GAGAAGAAGTTCTTGCGTCGGTTTACCGTCTTGCCCGTCGACGTGCCGCTGCTAGCTCGCTGGATGCTCGAGGTT
CGCGAGCCGGCCAAGATCCTCGACATGAGGCTTGAACTCATCGGGCTCGTCTCCTCTTGGGCTGATGTTCACTTT
GGCGGTGCTGATGGGAGGTGGTTGGCCGTTGATGATACCGGCGGTTTGCTGGTGGCTGCCATGGCCGAGTCGATG
GGCATCTTGCACCGGCATCCGGCGACCGAGACCGATGGAAAGGAGGGAAAGGAGGACGGCCATGACGAGGTCGAA
CCCGTCGACAGCCGCGCAACTGACGAGACGTCCCCCGATAATCGTCCGACGAAGCTCGCTCATCTTCGCAAACGT
CCCCGACGCGACGACCTCGACGACCACTACGCCCCCGGAAACACAATCACTCTCCTCCACGCAAACTCACAGCCC
AACCTCTCCCTCCTCCGCTACTTCGATTACGACGCCAGCGACCCCAACCCTCCAGCCCCCCACCATCCGCTCTTC
ACCCACCTACTCTCCCTATCGTGGCTCCAACTCGTCAGTCCAGAAAGCGACCCAGCCTACGCCGAGCGTCCGGCC
GACGTACCGGCCGAAGAGCTCGCGGCGTGGAAACCGAACCGACGCGGCAACTACTTCCGGAAGCGCCGCCGCTGG
GCCCGCACCCGACAGGTCGTAGAGGGCGCACGCGCGGGTGGGTTCAGCGGCCTGGCCGTCGCCAGCGCCATGGAT
CCCATCTCCGTCCTCCGGCACGCGCTGCCGCTGCTCTCCGGCGGGAGTCCGATCGCCGTCTACTCGCCGCACATC
GAGCCGCTGACCAAGCTGGCCGATTGCTTCACCATCGCCCGTCGCGCCGCCTGGCTTTCTTCGCCGCCCGCCGAC
GCCGAGGGCCGTACTCAGGCCGAGCTGGAGCGCTGGACGGGGACGGCCGAGTTCCCTCTCAACCCGACGCTCGTC
TTGGGCGCCACGGTGCACACCAGTCGGGCTAAGCGGTGGCAGGTCCTTCCGGGACGGACGCACCCGTACATGACG
GCTCGTGGCGGCTCGGACGGCTACGTCTTTACCGGCTGGCGGGCGATTCCGGCCGAGGGGAGGGTTTCGGCGAGG
GGCAAGTTTCAGAAGAAAAAGGCGTGCGGCGGGTGA
Transcript >Ophcf2|03700
ATGATGCTCGCTCGCGGTGGACTGGCAGCACGTGACCCTCTGCAGGGCATAACCCTGGTCAACCTTCAGAAGCCC
GACGCCCATCACGGAACCAAAAGAAAGCCGCTGATGGCCGCTCGCAACTCGATCCAGCCCCATGGCTGGGCGGCG
CTAAAGCTCCCCAACGAGACACTGCGCGTGCTACAGGTGACGCCCAATACAACCATCTCCCTCGGCAAATACGGC
TCCTTCCCGAGCAACCTGCTGATAGAGCGGCCCTTTCACCTGACGTACGAAGTCTCGGAGCGTCGAGAAGGAGAG
TCCTTTTCACGACTGCGCATCGTTCCGGGCACGGAGCTCAACGCCGACCTCTTGGCCGCCGACAACGATGACTTG
GACGAATCGGCGCTGGTGGACGAAGCTGCTTGTCGCCTGGGGCCGCCGGACGAAGACGACGACCCGGGCGGTTCA
AGGCGGCAGACGCTGACGACGGCCGAGATCGAGGACCTCAAGCGACGGGGCGCCGACGCGGGAAAGGAGCTCATC
GCCAAACTCATGCTTTCCCACACGGCTCTCGATCAAAAGTCTGCCTTTTCGCTGGCCAAGTATCGGCTTCTCAAG
GAGAAGAAGTTCTTGCGTCGGTTTACCGTCTTGCCCGTCGACGTGCCGCTGCTAGCTCGCTGGATGCTCGAGGTT
CGCGAGCCGGCCAAGATCCTCGACATGAGGCTTGAACTCATCGGGCTCGTCTCCTCTTGGGCTGATGTTCACTTT
GGCGGTGCTGATGGGAGGTGGTTGGCCGTTGATGATACCGGCGGTTTGCTGGTGGCTGCCATGGCCGAGTCGATG
GGCATCTTGCACCGGCATCCGGCGACCGAGACCGATGGAAAGGAGGGAAAGGAGGACGGCCATGACGAGGTCGAA
CCCGTCGACAGCCGCGCAACTGACGAGACGTCCCCCGATAATCGTCCGACGAAGCTCGCTCATCTTCGCAAACGT
CCCCGACGCGACGACCTCGACGACCACTACGCCCCCGGAAACACAATCACTCTCCTCCACGCAAACTCACAGCCC
AACCTCTCCCTCCTCCGCTACTTCGATTACGACGCCAGCGACCCCAACCCTCCAGCCCCCCACCATCCGCTCTTC
ACCCACCTACTCTCCCTATCGTGGCTCCAACTCGTCAGTCCAGAAAGCGACCCAGCCTACGCCGAGCGTCCGGCC
GACGTACCGGCCGAAGAGCTCGCGGCGTGGAAACCGAACCGACGCGGCAACTACTTCCGGAAGCGCCGCCGCTGG
GCCCGCACCCGACAGGTCGTAGAGGGCGCACGCGCGGGTGGGTTCAGCGGCCTGGCCGTCGCCAGCGCCATGGAT
CCCATCTCCGTCCTCCGGCACGCGCTGCCGCTGCTCTCCGGCGGGAGTCCGATCGCCGTCTACTCGCCGCACATC
GAGCCGCTGACCAAGCTGGCCGATTGCTTCACCATCGCCCGTCGCGCCGCCTGGCTTTCTTCGCCGCCCGCCGAC
GCCGAGGGCCGTACTCAGGCCGAGCTGGAGCGCTGGACGGGGACGGCCGAGTTCCCTCTCAACCCGACGCTCGTC
TTGGGCGCCACGGTGCACACCAGTCGGGCTAAGCGGTGGCAGGTCCTTCCGGGACGGACGCACCCGTACATGACG
GCTCGTGGCGGCTCGGACGGCTACGTCTTTACCGGCTGGCGGGCGATTCCGGCCGAGGGGAGGGTTTCGGCGAGG
GGCAAGTTTCAGAAGAAAAAGGCGTGCGGCGGGTGA
Gene >Ophcf2|03700
ATGATGCTCGCTCGCGGTGGACTGGCAGCACGTGACCCTCTGCAGGGCATAACCCTGGTCAACCTTCAGAAGCCC
GACGCCCATCACGGAACCAAAAGAAAGCCGCTGATGGCCGCTCGCAACTCGATCCAGCCCCATGGCTGGGCGGCG
CTAAAGCTCCCCAACGAGACACTGCGCGTGCTACAGGTGACGCCCAATACGTGAGAGAGGGAGAGCCAAACCCCG
ACAGTCTCATTCAGCAAACTGACCGAACCAGAACCATCTCCCTCGGCAAATACGGCTCCTTCCCGAGCAACCTGC
TGATAGAGCGGCCCTTTCACCTGACGTACGAAGTCTCGGAGCGTCGAGAAGGAGAGTCCTTTTCACGACTGCGCA
TCGTTCCGGGCACGGAGCTCAACGCCGACCTCTTGGCCGCCGACAACGATGACTTGGACGAATCGGCGCTGGTGG
ACGAAGCTGCTTGTCGCCTGGGGCCGCCGGACGAAGACGACGACCCGGGCGGTTCAAGGCGGCAGACGCTGACGA
CGGCCGAGATCGAGGACCTCAAGCGACGGGGCGCCGACGCGGGAAAGGAGCTCATCGCCAAACTCATGCTTTCCC
ACACGGCTCTCGATCAAAAGTCTGCCTTTTCGCTGGCCAAGTATCGGCTTCTCAAGGAGAAGAAGTTCTTGCGTC
GGTTTACCGTCTTGCCCGTCGACGTGCCGCTGCTAGCTCGCTGGATGCTCGAGGTTCGCGAGCCGGCCAAGATCC
TCGACATGAGGCTTGAACTCATCGGGCTCGTCTCCTCTTGGGCTGATGTTCACTTTGGCGGTGCTGATGGGAGGT
GGTTGGCCGTTGATGATACCGGCGGTTTGCTGGTGGCTGCCATGGCCGAGTCGATGGGCATCTTGCACCGGCATC
CGGCGACCGAGACCGATGGAAAGGAGGGAAAGGAGGACGGCCATGACGAGGTCGAACCCGTCGACAGCCGCGCAA
CTGACGAGACGTCCCCCGATAATCGTCCGACGAAGCTCGCTCATCTTCGCAAACGTCCCCGACGCGACGACCTCG
ACGACCACTACGCCCCCGGAAACACAATCACTCTCCTCCACGCAAACTCACAGCCCAACCTCTCCCTCCTCCGCT
ACTTCGATTACGACGCCAGCGACCCCAACCCTCCAGCCCCCCACCATCCGCTCTTCACCCACCTACTCTCCCTAT
CGTGGCTCCAACTCGTCAGTCCAGAAAGCGACCCAGCCTACGCCGAGCGTCCGGCCGACGTACCGGCCGAAGAGC
TCGCGGCGTGGAAACCGAACCGACGCGGCAACTACTTCCGGAAGCGCCGCCGCTGGGCCCGCACCCGACAGGTCG
TAGAGGGCGCACGCGCGGGTGGGTTCAGCGGCCTGGCCGTCGCCAGCGCCATGGATCCCATCTCCGTCCTCCGGC
ACGCGCTGCCGCTGCTCTCCGGCGGGAGTCCGATCGCCGTCTACTCGCCGCACATCGAGCCGCTGACCAAGCTGG
CCGATTGCTTCACCATCGCCCGTCGCGCCGCCTGGCTTTCTTCGCCGCCCGCCGACGCCGAGGGCCGTACTCAGG
CCGAGCTGGAGCGCTGGACGGGGACGGCCGAGTTCCCTCTCAACCCGACGCTCGTCTTGGGCGCCACGGTGCACA
CCAGTCGGGCTAAGCGGTGGCAGGTCCTTCCGGGACGGACGCACCCGTACATGACGGCTCGTGGCGGCTCGGACG
GCTACGTCTTTACCGGCTGGCGGGCGATTCCGGCCGAGGGGAGGGTTTCGGCGAGGGGCAAGTTTCAGAAGAAAA
AGGCGTGCGGCGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail