Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03696
Gene name
Locationscaffold_03:3571546..3574408
Strand+
Gene length (bp)2862
Transcript length (bp)2661
Coding sequence length (bp)2661
Protein length (aa) 887

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01433 Peptidase_M1 Peptidase family M1 domain 2.4E-79 272 489
PF11838 ERAP1_C ERAP1-like C-terminal domain 1.7E-77 566 882
PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain 6.4E-41 31 232

GO

GO Term Description Terminal node
GO:0008237 metallopeptidase activity Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.5705 0.2745 0.7408 0.0299 0.2749 0.1061 0.1003 0.0979 0.1711 0.0899

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup135
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1094
Ophiocordyceps australis 1348a (Ghana) OphauG2|6966
Ophiocordyceps australis map64 (Brazil) OphauB2|2827
Ophiocordyceps australis map64 (Brazil) OphauB2|3653
Ophiocordyceps camponoti-floridani Ophcf2|00006
Ophiocordyceps camponoti-floridani Ophcf2|03696 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|333
Ophiocordyceps camponoti-rufipedis Ophun1|6470
Ophiocordyceps kimflemingae Ophio5|4442
Ophiocordyceps kimflemingae Ophio5|5778
Ophiocordyceps subramaniannii Hirsu2|10785
Ophiocordyceps subramaniannii Hirsu2|9568

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03696
MRHSVPRTAAAAPLASLDIMADRDILPRHLKPAHYRLCLSGFDFKAWTYKGTVTIEAEIVEPTDRIVVNALELKI
SHASVTVDQAKSSQSFETTDVSYDGRAQRATIKFDSQLPVARRAAVVVDFEGVINNDMAGFYRSRYRPEVMPPAE
AGVPHDDEWHYMLSTQFESCDARRAFPCFDEPNLKASFDLELEMPSGLVALANMPVREERPSGRDGFKLVSFETT
PVMSTYLLAWAVGDFKYVEALTERRYNGKRLPVRVYATRGLEEQGRWALEHAHKIIDFFSTVFGIDYPLPKADLL
AVHEFTHGAMENWGLVTYRTTAVLYDERTSDARFRNAVAYVVAHELAHQWFGNLVTMDWWDELWLNEGFATWVGW
YAIDHLHPDWEVWAQFINEGMEAAFRLDGIRASHPIHVPVRDALDVNQIFDNISYLKGCSVIRMLAAHLGVEVFL
SGVSRYLAAHTYGNARTDDLWRALTEASGQDVTALMGPWISRVGHPVLTVAEEPGQLTVAQSRYLSSGDVGPDDD
VTTWWLPLGFEGRRGGRAGVADKGLSLTTKKETIRDVDDGFYKFNSGATGFYRVSYPPARLARMSTQLARLSAED
RIAIIGSTAEMAFSGHGTTASLLTLLVGFRDETHPIVWTQLLDSIDSVRSVFGGDAELRGGIDALARDLVDKKVR
EVGWESAADEGYLGSILRKQLMNAALGCRHAATVDEALGRFDAWVSDPEKNPIPPSLRVAVWRAAARADAKRAFA
VLKKEWSTTKSVDGKLLCLQAMGAAQDEEAIRTAILPFNFGTSSDSVPAGDMHVLGQALAEHPVGRDAQWAYLKA
NWEACVAKLGNPIVLDRFVRLSLGSFVDEGVVSDMDAFFEGKDTGAFNRTLGTVRDRGYLQ*
Coding >Ophcf2|03696
ATGCGCCACTCTGTCCCCCGCACTGCTGCTGCAGCCCCGCTCGCCAGCCTAGACATCATGGCCGATCGCGATATC
CTCCCCCGCCACCTCAAGCCCGCCCACTACCGGCTGTGCCTATCGGGCTTCGACTTTAAGGCTTGGACCTACAAG
GGCACCGTTACCATCGAGGCCGAGATTGTCGAGCCGACGGACCGCATCGTCGTCAATGCTCTCGAGCTCAAGATC
TCGCACGCCTCCGTCACTGTCGATCAGGCCAAGTCGTCGCAGTCGTTCGAGACGACCGACGTCAGCTACGATGGT
CGCGCTCAGCGGGCTACCATCAAGTTCGACAGTCAGCTGCCCGTCGCTCGTCGTGCCGCCGTCGTCGTCGACTTT
GAGGGCGTCATCAACAATGACATGGCCGGCTTTTACCGCAGCCGCTACCGGCCCGAGGTGATGCCCCCGGCCGAG
GCGGGCGTGCCGCACGACGACGAGTGGCACTACATGTTGAGCACGCAGTTTGAATCGTGCGATGCCCGTCGCGCC
TTTCCTTGCTTCGACGAGCCCAATCTCAAGGCCAGCTTCGACTTGGAGCTTGAGATGCCTTCGGGTTTGGTGGCG
CTCGCCAATATGCCGGTCCGGGAAGAGAGACCTTCGGGACGCGACGGCTTCAAGTTGGTGTCGTTTGAGACGACG
CCCGTCATGAGCACCTATCTTCTTGCCTGGGCCGTCGGTGACTTTAAGTACGTCGAGGCCCTCACGGAACGGCGC
TACAATGGCAAGCGGCTGCCGGTGCGCGTCTATGCCACCCGAGGCCTGGAAGAGCAGGGCAGGTGGGCGCTCGAG
CACGCGCACAAGATCATCGACTTCTTCTCGACCGTCTTCGGCATCGACTATCCGCTGCCCAAGGCAGACCTGCTG
GCAGTGCACGAGTTTACGCATGGCGCCATGGAGAATTGGGGGCTCGTCACCTACCGGACCACGGCCGTTCTCTAC
GACGAGCGCACGTCTGACGCTCGTTTCCGCAACGCCGTCGCCTACGTCGTCGCTCACGAATTGGCCCATCAGTGG
TTCGGGAACCTCGTCACCATGGACTGGTGGGACGAGCTCTGGCTCAACGAGGGCTTCGCCACCTGGGTTGGATGG
TACGCCATCGACCATCTGCACCCTGACTGGGAGGTCTGGGCCCAGTTCATCAACGAGGGCATGGAGGCTGCCTTT
CGACTCGACGGCATCCGCGCCAGCCACCCGATCCATGTACCGGTCCGCGACGCCCTCGACGTCAACCAGATCTTT
GACAACATCAGCTACCTCAAGGGTTGCTCCGTCATCCGCATGCTGGCCGCTCACCTGGGCGTCGAGGTCTTTCTC
TCCGGCGTCTCGCGTTACCTCGCCGCCCATACGTACGGCAACGCCCGGACCGACGACCTGTGGCGTGCCCTGACG
GAGGCCTCGGGCCAGGACGTGACGGCCCTAATGGGGCCCTGGATCTCCCGCGTCGGCCATCCGGTCCTGACGGTG
GCCGAGGAGCCGGGCCAGCTGACGGTGGCTCAGTCTCGCTACCTCTCGTCGGGCGATGTCGGACCCGACGACGAC
GTCACCACCTGGTGGCTGCCCCTGGGCTTCGAGGGCCGACGCGGAGGACGGGCGGGCGTGGCGGACAAGGGCCTA
TCGCTGACGACGAAGAAGGAGACGATCCGCGACGTCGACGATGGCTTTTACAAGTTCAACAGCGGCGCCACCGGC
TTCTACCGCGTCAGTTACCCGCCCGCGCGCCTGGCCCGGATGAGCACGCAGCTGGCGCGCCTTTCAGCCGAGGAT
CGTATAGCCATCATCGGATCCACGGCCGAGATGGCGTTTTCGGGTCACGGGACGACGGCCTCGCTGCTGACGTTG
CTGGTCGGTTTCCGCGACGAGACGCACCCGATTGTGTGGACGCAGCTGCTCGACTCGATCGATTCGGTGCGGTCC
GTCTTTGGCGGAGACGCCGAGCTTCGGGGAGGGATCGATGCGCTGGCCCGTGACCTCGTCGACAAGAAGGTGCGC
GAGGTCGGCTGGGAGTCGGCGGCCGATGAGGGTTATCTGGGGAGTATCTTGCGGAAGCAGTTGATGAACGCGGCT
CTCGGATGTCGGCATGCGGCGACGGTAGATGAGGCCCTCGGCCGCTTCGACGCCTGGGTATCCGACCCGGAAAAG
AATCCGATCCCTCCGTCGCTGCGAGTCGCCGTCTGGCGCGCAGCTGCTCGAGCCGACGCGAAACGCGCCTTTGCC
GTGCTCAAGAAGGAATGGTCAACGACCAAGTCGGTCGACGGCAAGCTCCTCTGCCTACAAGCCATGGGCGCAGCC
CAAGACGAAGAAGCCATCCGCACGGCCATCCTACCCTTCAACTTCGGCACCTCTAGCGACTCAGTCCCGGCGGGA
GACATGCACGTTCTCGGCCAGGCGCTCGCCGAGCACCCAGTCGGCCGGGACGCGCAGTGGGCGTACCTGAAGGCG
AACTGGGAGGCCTGCGTTGCGAAGCTGGGGAATCCGATCGTGCTGGATCGCTTTGTGAGGCTTTCGCTGGGGAGC
TTTGTTGATGAGGGGGTCGTGAGCGACATGGATGCCTTCTTCGAGGGGAAGGATACGGGGGCTTTCAATCGGACC
CTGGGGACGGTCAGGGATAGGGGGTATCTGCAGTAG
Transcript >Ophcf2|03696
ATGCGCCACTCTGTCCCCCGCACTGCTGCTGCAGCCCCGCTCGCCAGCCTAGACATCATGGCCGATCGCGATATC
CTCCCCCGCCACCTCAAGCCCGCCCACTACCGGCTGTGCCTATCGGGCTTCGACTTTAAGGCTTGGACCTACAAG
GGCACCGTTACCATCGAGGCCGAGATTGTCGAGCCGACGGACCGCATCGTCGTCAATGCTCTCGAGCTCAAGATC
TCGCACGCCTCCGTCACTGTCGATCAGGCCAAGTCGTCGCAGTCGTTCGAGACGACCGACGTCAGCTACGATGGT
CGCGCTCAGCGGGCTACCATCAAGTTCGACAGTCAGCTGCCCGTCGCTCGTCGTGCCGCCGTCGTCGTCGACTTT
GAGGGCGTCATCAACAATGACATGGCCGGCTTTTACCGCAGCCGCTACCGGCCCGAGGTGATGCCCCCGGCCGAG
GCGGGCGTGCCGCACGACGACGAGTGGCACTACATGTTGAGCACGCAGTTTGAATCGTGCGATGCCCGTCGCGCC
TTTCCTTGCTTCGACGAGCCCAATCTCAAGGCCAGCTTCGACTTGGAGCTTGAGATGCCTTCGGGTTTGGTGGCG
CTCGCCAATATGCCGGTCCGGGAAGAGAGACCTTCGGGACGCGACGGCTTCAAGTTGGTGTCGTTTGAGACGACG
CCCGTCATGAGCACCTATCTTCTTGCCTGGGCCGTCGGTGACTTTAAGTACGTCGAGGCCCTCACGGAACGGCGC
TACAATGGCAAGCGGCTGCCGGTGCGCGTCTATGCCACCCGAGGCCTGGAAGAGCAGGGCAGGTGGGCGCTCGAG
CACGCGCACAAGATCATCGACTTCTTCTCGACCGTCTTCGGCATCGACTATCCGCTGCCCAAGGCAGACCTGCTG
GCAGTGCACGAGTTTACGCATGGCGCCATGGAGAATTGGGGGCTCGTCACCTACCGGACCACGGCCGTTCTCTAC
GACGAGCGCACGTCTGACGCTCGTTTCCGCAACGCCGTCGCCTACGTCGTCGCTCACGAATTGGCCCATCAGTGG
TTCGGGAACCTCGTCACCATGGACTGGTGGGACGAGCTCTGGCTCAACGAGGGCTTCGCCACCTGGGTTGGATGG
TACGCCATCGACCATCTGCACCCTGACTGGGAGGTCTGGGCCCAGTTCATCAACGAGGGCATGGAGGCTGCCTTT
CGACTCGACGGCATCCGCGCCAGCCACCCGATCCATGTACCGGTCCGCGACGCCCTCGACGTCAACCAGATCTTT
GACAACATCAGCTACCTCAAGGGTTGCTCCGTCATCCGCATGCTGGCCGCTCACCTGGGCGTCGAGGTCTTTCTC
TCCGGCGTCTCGCGTTACCTCGCCGCCCATACGTACGGCAACGCCCGGACCGACGACCTGTGGCGTGCCCTGACG
GAGGCCTCGGGCCAGGACGTGACGGCCCTAATGGGGCCCTGGATCTCCCGCGTCGGCCATCCGGTCCTGACGGTG
GCCGAGGAGCCGGGCCAGCTGACGGTGGCTCAGTCTCGCTACCTCTCGTCGGGCGATGTCGGACCCGACGACGAC
GTCACCACCTGGTGGCTGCCCCTGGGCTTCGAGGGCCGACGCGGAGGACGGGCGGGCGTGGCGGACAAGGGCCTA
TCGCTGACGACGAAGAAGGAGACGATCCGCGACGTCGACGATGGCTTTTACAAGTTCAACAGCGGCGCCACCGGC
TTCTACCGCGTCAGTTACCCGCCCGCGCGCCTGGCCCGGATGAGCACGCAGCTGGCGCGCCTTTCAGCCGAGGAT
CGTATAGCCATCATCGGATCCACGGCCGAGATGGCGTTTTCGGGTCACGGGACGACGGCCTCGCTGCTGACGTTG
CTGGTCGGTTTCCGCGACGAGACGCACCCGATTGTGTGGACGCAGCTGCTCGACTCGATCGATTCGGTGCGGTCC
GTCTTTGGCGGAGACGCCGAGCTTCGGGGAGGGATCGATGCGCTGGCCCGTGACCTCGTCGACAAGAAGGTGCGC
GAGGTCGGCTGGGAGTCGGCGGCCGATGAGGGTTATCTGGGGAGTATCTTGCGGAAGCAGTTGATGAACGCGGCT
CTCGGATGTCGGCATGCGGCGACGGTAGATGAGGCCCTCGGCCGCTTCGACGCCTGGGTATCCGACCCGGAAAAG
AATCCGATCCCTCCGTCGCTGCGAGTCGCCGTCTGGCGCGCAGCTGCTCGAGCCGACGCGAAACGCGCCTTTGCC
GTGCTCAAGAAGGAATGGTCAACGACCAAGTCGGTCGACGGCAAGCTCCTCTGCCTACAAGCCATGGGCGCAGCC
CAAGACGAAGAAGCCATCCGCACGGCCATCCTACCCTTCAACTTCGGCACCTCTAGCGACTCAGTCCCGGCGGGA
GACATGCACGTTCTCGGCCAGGCGCTCGCCGAGCACCCAGTCGGCCGGGACGCGCAGTGGGCGTACCTGAAGGCG
AACTGGGAGGCCTGCGTTGCGAAGCTGGGGAATCCGATCGTGCTGGATCGCTTTGTGAGGCTTTCGCTGGGGAGC
TTTGTTGATGAGGGGGTCGTGAGCGACATGGATGCCTTCTTCGAGGGGAAGGATACGGGGGCTTTCAATCGGACC
CTGGGGACGGTCAGGGATAGGGGGTATCTGCAGTAG
Gene >Ophcf2|03696
ATGCGCCACTCTGTCCCCCGCACTGCTGCTGCAGCCCCGCTCGCCAGGTGATAAATAGGCCAGCCGTCGTTGCAT
CGTCCGTGCGCTGATTCTCGTCCCTTCACCATCTTGTTCTGTTCAGCCTAGACATCATGGCCGATCGCGATATCC
TCCCCCGCCACCTCAAGCCCGCCCACTACCGGCTGTGCCTATCGGGCTTCGACTTTAAGGCTTGGACCTACAAGG
GCACCGTTACCATCGAGGCCGAGATTGTCGAGCCGACGGACCGCATCGTCGTCAATGCTCTCGAGCTCAAGATCT
CGCACGCCTCCGTCACTGTCGATCAGGCCAAGTCGTCGCAGTCGTTCGAGACGACCGACGTCAGCTACGATGGTC
GCGCTCAGCGGGCTACCATCAAGTTCGACAGTCAGCTGCCCGTCGCTCGTCGTGCCGCCGTCGTCGTCGACTTTG
AGGGCGTCATCAACAATGACATGGCCGGCTTTTACCGCAGCCGCTACCGGCCCGAGGTGATGCCCCCGGCCGAGG
CGGGCGTGCCGCACGACGACGAGTGGCACTACATGTTGAGCACGCAGTTTGAATCGTGCGATGCCCGTCGCGCCT
TTCCTTGCTTCGACGAGCCCAATCTCAAGGCCAGCTTCGACTTGGAGCTTGAGATGCCTTCGGGTTTGGTGGCGC
TCGCCAATATGCCGGTCCGGGAAGAGAGACCTTCGGGACGCGACGGCTTCAAGTTGGTGTCGTTTGAGACGACGC
CCGTCATGAGCACCTATCTTCTTGCCTGGGCCGTCGGTGACTTTAAGTACGTCGAGGCCCTCACGGAACGGCGCT
ACAATGGCAAGCGGCTGCCGGTGCGCGTCTATGCCACCCGAGGCCTGGAAGAGCAGGGCAGGTGGGCGCTCGAGC
ACGCGCACAAGATCATCGACTTCTTCTCGACCGTCTTCGGCATCGACTATCCGCTGCCCAAGGCAGACCTGCTGG
CAGTGCACGAGTTTACGCATGGCGCCATGGAGAATTGGGGGCTCGTCACCTACCGGACCACGGCCGTTCTCTACG
ACGAGCGCACGTCTGACGCTCGTTTCCGCAACGCCGTCGCCTACGTCGTCGCTCACGAATTGGCCCATCAGTGGT
TCGGGAACCTCGTCACCATGGACTGGTGGGACGAGCTCTGGCTCAACGAGGGCTTCGCCACCTGGGTTGGATGGT
ACGCCATCGACCATCTGCACCCTGACTGGGAGGTCTGGGCCCAGTTCATCAACGAGGGCATGGAGGCTGCCTTTC
GACTCGACGGCATCCGCGCCAGCCACCCGATCCATGTACCGGTCCGCGACGCCCTCGACGTCAACCAGATCTTTG
ACAACATCAGCTACCTCAAGGGTTGCTCCGTCATCCGCATGCTGGCCGCTCACCTGGGCGTCGAGGTCTTTCTCT
CCGGCGTCTCGCGTTACCTCGCCGCCCATACGTACGGCAACGCCCGGACCGACGACCTGTGGCGTGCCCTGACGG
AGGCCTCGGGCCAGGACGTGACGGCCCTAATGGGGCCCTGGATCTCCCGCGTCGGCCATCCGGTCCTGACGGTGG
CCGAGGAGCCGGGCCAGCTGACGGTGGCTCAGTCTCGCTACCTCTCGTCGGGCGATGTCGGACCCGACGACGACG
TCACCACCTGGTGGCTGCCCCTGGGCTTCGAGGGCCGACGCGGAGGACGGGCGGGCGTGGCGGACAAGGGCCTAT
CGCTGACGACGAAGAAGGAGACGATCCGCGACGTCGACGATGGCTTTTACAAGTTCAACAGCGGCGCCACCGGCT
TCTACCGCGTCAGTTACCCGCCCGCGCGCCTGGCCCGGATGAGCACGCAGCTGGCGCGCCTTTCAGCCGAGGATC
GTATAGCCATCATCGGATCCACGGCCGAGATGGCGTTTTCGGGTCACGGGACGACGGCCTCGCTGCTGACGTTGC
TGGTCGGTTTCCGCGACGAGACGCACCCGATTGTGTGGACGCAGCTGCTCGACTCGATCGATTCGGTGCGGTCCG
TCTTTGGCGGAGACGCCGAGCTTCGGGGAGGGATCGATGCGCTGGCCCGTGACCTCGTCGACAAGAAGGTGCGCG
AGGTCGGCTGGGAGTCGGCGGCCGATGAGGGTTATCTGGGGAGTATCTTGCGGAAGCAGTTGATGAACGCGGCTC
TCGGATGTCGGCATGCGGCGTGAGTATTGTCCGTTCCGTGTCAAGTCATCAAGATACAGCACAGCTAACGGGTCT
ACCAGGACGGTAGATGAGGCCCTCGGCCGCTTCGACGCCTGGGTATCCGACCCGGAAAAGAATCCGATCCCTCCG
TCGCTGCGAGTCGCCGTCTGGCGCGCAGCTGCTCGAGCCGACGCGAAACGCGCCTTTGCCGTGCTCAAGAAGGAA
TGGTCAACGACCAAGTCGGTCGACGGCAAGCTCCTCTGCCTACAAGCCATGGGCGCAGCCCAAGACGAAGAAGCC
ATCCGCACGGCCATCCTACCCTTCAACTTCGGCACCTCTAGCGACTCAGTCCCGGCGGGAGACATGCACGTTCTC
GGCCAGGCGCTCGCCGAGCACCCAGTCGGCCGGGACGCGCAGTGGGCGTACCTGAAGGCGAACTGGGAGGCCTGC
GTTGCGAAGCTGGGGAATCCGATCGTGCTGGATCGCTTTGTGAGGCTTTCGCTGGGGAGCTTTGTTGATGAGGGG
GTCGTGAGCGACATGGATGCCTTCTTCGAGGGGAAGGATACGGGGGCTTTCAATCGGACCCTGGGGACGGTCAGG
GATAGGGTGAGGGTGAGGGCTAGGTACAGGGGGAGGGATGGGGGTGGGTTGAGGGAGTGGTTGGCTTCGAAGGGG
TATCTGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail