Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03694
Gene name
Locationscaffold_03:3564162..3566956
Strand+
Gene length (bp)2794
Transcript length (bp)2736
Coding sequence length (bp)2736
Protein length (aa) 912

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00102 Y_phosphatase Protein-tyrosine phosphatase 1.1E-30 518 608
PF00102 Y_phosphatase Protein-tyrosine phosphatase 3.7E-17 675 795
PF00581 Rhodanese Rhodanese-like domain 1.2E-08 267 381

GO

GO Term Description Terminal node
GO:0006470 protein dephosphorylation Yes
GO:0004725 protein tyrosine phosphatase activity Yes
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0036211 protein modification process No
GO:0042578 phosphoric ester hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0016311 dephosphorylation No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016791 phosphatase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0043412 macromolecule modification No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7046 0.5396 0.2549 0.1927 0.1029 0.005 0.0518 0.0856 0.0783 0.0169

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5135
Ophiocordyceps australis map64 (Brazil) OphauB2|1533
Ophiocordyceps camponoti-floridani Ophcf2|03694 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2361
Ophiocordyceps kimflemingae Ophio5|7693
Ophiocordyceps subramaniannii Hirsu2|5793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03694
MKTHSRSAAAGASVCHAAVAHPPRSAKSARPNTTTPLASPRGPYSVGQSTPPKLSPARHHDARASSPNYFGLVVD
SSNDTRESMGLARENWSPASSSVKSFAAALPKQLPLEPNSEFEAFRRQADLNWSKPFALPAVPHKKAASVRTRPP
RLSTSASDVSSAPDAATCTKMDVDHDTQADGSADGNVRPPPVPTQITSMRMSRSPQGMDSPRRSPTASDLNEARL
SLAIDPPRPSSPGPVETGPRAITLPPKLDGGGPSMISDTCLKELMESIADDQLLVLDIRSLQSFAQSRIRGALNL
CIPTTLLKRPNFNIEKLQQTFQGGAASDKFADWRRMSWIIVYDAHGWESREAVTAQNMIKKFTNEGFKGETAILR
GGFGVFHKSYPHLVDDGSTTPAAAHGGRNGRGNGGLAPVIGGVNLPASTSEVDPFFSNIRQNVDLADGVGQMEVT
RPSGLDSPLLPQWLREAASKIDRGRRVADKFLRIELDEQARMRSAYAAFQPGAQGRARIQLSGVEKGSKNRYKDI
LPFEHARVRLQSKPAGSCDYVNASHLGASRSHKRYIASQGPLPATFEDFWSVIWEQDVRVIVMLTAETEGGQLKC
HPYWKGREFGPIRLRPLSEKRALLDMDKHRGDTCAACSAAEFGRKRANTTTTLEAAATPGCASCQGQGQGQGQSE
APYVVIRKFALAHMAHPFASMREITHLHFPAWPDFGTPAKASHLLALVELANLMHRAARPVETTTLVSDDYVPAS
WYDEPENEAQPRPMMVHCSAGCGRTGTFCAVDSVIDMLKRQRQAKLAAARDGCGGVDADDEAISPRSVVQGPLPG
TTPAPGTAGPEAAWVRDETEDLIQATVQDFREQRLSMVQSLRQYVLCYETIVEWVHRVNERAAGGRLRSGSLQQP
RRNNQRNKGYE*
Coding >Ophcf2|03694
ATGAAGACTCACTCGAGGTCGGCCGCAGCTGGAGCTTCCGTCTGCCACGCCGCCGTGGCCCACCCTCCGCGTTCT
GCCAAGTCGGCCAGGCCTAATACGACGACGCCACTGGCCTCGCCTCGCGGCCCTTACTCCGTCGGCCAAAGTACG
CCTCCAAAGCTGTCACCCGCCCGCCACCACGACGCCCGAGCCTCGAGTCCCAATTACTTTGGCCTCGTCGTCGAC
TCTTCCAACGACACGCGCGAATCCATGGGGCTGGCACGCGAAAACTGGAGTCCTGCCTCGTCCTCGGTCAAGTCT
TTTGCCGCCGCCCTGCCGAAGCAGCTTCCCCTAGAGCCAAATTCCGAGTTTGAGGCCTTTCGACGCCAGGCCGAC
CTGAACTGGTCCAAGCCGTTTGCTCTGCCTGCCGTACCGCACAAGAAGGCCGCCAGTGTCCGCACCCGTCCGCCC
AGACTGTCGACATCGGCTAGCGATGTTTCTTCGGCCCCAGACGCCGCGACCTGCACCAAGATGGATGTCGACCAC
GACACCCAGGCCGACGGCTCTGCCGATGGCAACGTCAGGCCCCCCCCTGTCCCTACGCAAATCACCTCGATGCGC
ATGAGCAGGTCGCCGCAAGGCATGGACTCGCCACGTCGTTCCCCGACGGCATCCGACCTGAACGAAGCCCGCTTG
TCTCTGGCAATCGACCCTCCAAGGCCATCGTCTCCCGGACCGGTCGAGACGGGCCCCCGTGCCATCACGCTTCCT
CCCAAGCTGGACGGCGGCGGCCCGTCCATGATATCAGACACCTGCCTCAAAGAGCTTATGGAATCGATAGCCGAT
GACCAACTCCTAGTGCTGGATATTCGATCCCTGCAGAGTTTCGCCCAGTCTCGCATCAGGGGCGCGCTGAATCTC
TGCATCCCCACAACGCTGCTCAAGCGGCCTAATTTTAACATTGAAAAGTTGCAGCAGACGTTTCAGGGCGGCGCG
GCATCGGACAAGTTTGCCGACTGGCGGCGCATGTCGTGGATCATCGTGTACGACGCGCACGGCTGGGAGAGCCGC
GAGGCCGTAACGGCGCAGAACATGATTAAGAAGTTTACAAACGAGGGCTTCAAAGGCGAGACGGCTATCCTGCGC
GGCGGCTTTGGCGTCTTTCACAAATCCTATCCCCATCTCGTCGACGACGGTTCGACCACGCCGGCCGCGGCCCAC
GGAGGGCGTAATGGCCGCGGCAACGGAGGCTTGGCGCCCGTCATCGGCGGCGTCAATCTCCCGGCCTCTACCAGC
GAGGTGGATCCCTTCTTCTCTAATATCCGGCAGAACGTCGATCTCGCCGATGGCGTGGGACAGATGGAGGTCACG
CGGCCGTCGGGCTTGGATTCGCCCTTGCTTCCGCAGTGGTTGCGCGAGGCGGCCTCGAAGATTGATCGCGGCCGG
CGCGTGGCCGATAAGTTTTTGCGCATCGAGCTCGACGAGCAGGCTCGGATGCGCAGCGCGTATGCGGCCTTTCAA
CCTGGCGCTCAAGGACGAGCCCGGATTCAGCTATCGGGCGTCGAGAAGGGCAGCAAGAACCGATACAAAGATATC
TTACCGTTTGAGCACGCCCGTGTGCGGCTGCAGAGCAAGCCGGCCGGCTCGTGCGACTATGTCAACGCCAGCCAC
CTCGGGGCGTCTAGAAGCCACAAGCGGTACATTGCTTCGCAGGGCCCCTTGCCGGCCACGTTTGAGGACTTTTGG
TCCGTTATCTGGGAACAAGACGTGCGTGTCATTGTCATGCTGACGGCCGAGACGGAGGGCGGGCAGCTCAAGTGC
CATCCGTACTGGAAGGGCAGGGAGTTTGGGCCCATCAGGCTTCGGCCTCTGTCGGAGAAGAGGGCGTTGCTGGAC
ATGGACAAGCACCGAGGCGACACGTGCGCAGCCTGCTCTGCTGCCGAGTTTGGCCGGAAGCGGGCGAATACGACG
ACGACTCTCGAGGCGGCGGCGACGCCCGGCTGCGCCAGCTGCCAGGGTCAGGGTCAGGGTCAGGGGCAGTCCGAG
GCGCCGTACGTGGTGATCCGCAAGTTCGCACTGGCGCACATGGCGCACCCGTTCGCGTCTATGCGCGAGATCACG
CACCTGCACTTCCCGGCGTGGCCCGACTTTGGGACGCCGGCCAAGGCGTCGCACCTCCTGGCGCTGGTGGAGCTG
GCGAACCTGATGCACCGGGCAGCGCGTCCCGTGGAGACGACGACGCTGGTGTCGGACGACTACGTGCCGGCTTCT
TGGTACGACGAGCCGGAGAACGAGGCTCAGCCGCGGCCGATGATGGTGCACTGCTCGGCCGGCTGCGGGCGGACG
GGGACTTTTTGCGCCGTCGACAGCGTTATCGACATGCTGAAGCGGCAGCGGCAGGCCAAGCTGGCGGCGGCGCGG
GACGGGTGCGGCGGCGTGGATGCCGACGACGAGGCCATATCGCCGCGCAGCGTGGTCCAGGGGCCGTTGCCCGGT
ACCACTCCGGCTCCGGGAACGGCCGGACCGGAAGCGGCATGGGTCCGTGACGAGACGGAGGACTTGATCCAGGCG
ACGGTGCAAGACTTTCGCGAGCAGAGGCTCAGCATGGTGCAGAGCTTGCGGCAGTACGTGCTGTGCTACGAGACG
ATTGTCGAATGGGTGCACCGCGTCAACGAGAGAGCGGCCGGAGGACGGCTGCGGAGCGGGAGTCTGCAGCAGCCA
CGTCGGAACAATCAGCGCAACAAGGGTTATGAGTAA
Transcript >Ophcf2|03694
ATGAAGACTCACTCGAGGTCGGCCGCAGCTGGAGCTTCCGTCTGCCACGCCGCCGTGGCCCACCCTCCGCGTTCT
GCCAAGTCGGCCAGGCCTAATACGACGACGCCACTGGCCTCGCCTCGCGGCCCTTACTCCGTCGGCCAAAGTACG
CCTCCAAAGCTGTCACCCGCCCGCCACCACGACGCCCGAGCCTCGAGTCCCAATTACTTTGGCCTCGTCGTCGAC
TCTTCCAACGACACGCGCGAATCCATGGGGCTGGCACGCGAAAACTGGAGTCCTGCCTCGTCCTCGGTCAAGTCT
TTTGCCGCCGCCCTGCCGAAGCAGCTTCCCCTAGAGCCAAATTCCGAGTTTGAGGCCTTTCGACGCCAGGCCGAC
CTGAACTGGTCCAAGCCGTTTGCTCTGCCTGCCGTACCGCACAAGAAGGCCGCCAGTGTCCGCACCCGTCCGCCC
AGACTGTCGACATCGGCTAGCGATGTTTCTTCGGCCCCAGACGCCGCGACCTGCACCAAGATGGATGTCGACCAC
GACACCCAGGCCGACGGCTCTGCCGATGGCAACGTCAGGCCCCCCCCTGTCCCTACGCAAATCACCTCGATGCGC
ATGAGCAGGTCGCCGCAAGGCATGGACTCGCCACGTCGTTCCCCGACGGCATCCGACCTGAACGAAGCCCGCTTG
TCTCTGGCAATCGACCCTCCAAGGCCATCGTCTCCCGGACCGGTCGAGACGGGCCCCCGTGCCATCACGCTTCCT
CCCAAGCTGGACGGCGGCGGCCCGTCCATGATATCAGACACCTGCCTCAAAGAGCTTATGGAATCGATAGCCGAT
GACCAACTCCTAGTGCTGGATATTCGATCCCTGCAGAGTTTCGCCCAGTCTCGCATCAGGGGCGCGCTGAATCTC
TGCATCCCCACAACGCTGCTCAAGCGGCCTAATTTTAACATTGAAAAGTTGCAGCAGACGTTTCAGGGCGGCGCG
GCATCGGACAAGTTTGCCGACTGGCGGCGCATGTCGTGGATCATCGTGTACGACGCGCACGGCTGGGAGAGCCGC
GAGGCCGTAACGGCGCAGAACATGATTAAGAAGTTTACAAACGAGGGCTTCAAAGGCGAGACGGCTATCCTGCGC
GGCGGCTTTGGCGTCTTTCACAAATCCTATCCCCATCTCGTCGACGACGGTTCGACCACGCCGGCCGCGGCCCAC
GGAGGGCGTAATGGCCGCGGCAACGGAGGCTTGGCGCCCGTCATCGGCGGCGTCAATCTCCCGGCCTCTACCAGC
GAGGTGGATCCCTTCTTCTCTAATATCCGGCAGAACGTCGATCTCGCCGATGGCGTGGGACAGATGGAGGTCACG
CGGCCGTCGGGCTTGGATTCGCCCTTGCTTCCGCAGTGGTTGCGCGAGGCGGCCTCGAAGATTGATCGCGGCCGG
CGCGTGGCCGATAAGTTTTTGCGCATCGAGCTCGACGAGCAGGCTCGGATGCGCAGCGCGTATGCGGCCTTTCAA
CCTGGCGCTCAAGGACGAGCCCGGATTCAGCTATCGGGCGTCGAGAAGGGCAGCAAGAACCGATACAAAGATATC
TTACCGTTTGAGCACGCCCGTGTGCGGCTGCAGAGCAAGCCGGCCGGCTCGTGCGACTATGTCAACGCCAGCCAC
CTCGGGGCGTCTAGAAGCCACAAGCGGTACATTGCTTCGCAGGGCCCCTTGCCGGCCACGTTTGAGGACTTTTGG
TCCGTTATCTGGGAACAAGACGTGCGTGTCATTGTCATGCTGACGGCCGAGACGGAGGGCGGGCAGCTCAAGTGC
CATCCGTACTGGAAGGGCAGGGAGTTTGGGCCCATCAGGCTTCGGCCTCTGTCGGAGAAGAGGGCGTTGCTGGAC
ATGGACAAGCACCGAGGCGACACGTGCGCAGCCTGCTCTGCTGCCGAGTTTGGCCGGAAGCGGGCGAATACGACG
ACGACTCTCGAGGCGGCGGCGACGCCCGGCTGCGCCAGCTGCCAGGGTCAGGGTCAGGGTCAGGGGCAGTCCGAG
GCGCCGTACGTGGTGATCCGCAAGTTCGCACTGGCGCACATGGCGCACCCGTTCGCGTCTATGCGCGAGATCACG
CACCTGCACTTCCCGGCGTGGCCCGACTTTGGGACGCCGGCCAAGGCGTCGCACCTCCTGGCGCTGGTGGAGCTG
GCGAACCTGATGCACCGGGCAGCGCGTCCCGTGGAGACGACGACGCTGGTGTCGGACGACTACGTGCCGGCTTCT
TGGTACGACGAGCCGGAGAACGAGGCTCAGCCGCGGCCGATGATGGTGCACTGCTCGGCCGGCTGCGGGCGGACG
GGGACTTTTTGCGCCGTCGACAGCGTTATCGACATGCTGAAGCGGCAGCGGCAGGCCAAGCTGGCGGCGGCGCGG
GACGGGTGCGGCGGCGTGGATGCCGACGACGAGGCCATATCGCCGCGCAGCGTGGTCCAGGGGCCGTTGCCCGGT
ACCACTCCGGCTCCGGGAACGGCCGGACCGGAAGCGGCATGGGTCCGTGACGAGACGGAGGACTTGATCCAGGCG
ACGGTGCAAGACTTTCGCGAGCAGAGGCTCAGCATGGTGCAGAGCTTGCGGCAGTACGTGCTGTGCTACGAGACG
ATTGTCGAATGGGTGCACCGCGTCAACGAGAGAGCGGCCGGAGGACGGCTGCGGAGCGGGAGTCTGCAGCAGCCA
CGTCGGAACAATCAGCGCAACAAGGGTTATGAGTAA
Gene >Ophcf2|03694
ATGAAGACTCACTCGAGGTCGGCCGCAGCTGGAGCTTCCGTCTGCCACGCCGCCGTGGCCCACCCTCCGCGTTCT
GCCAAGTCGGCCAGGCCTAATACGACGACGCCACTGGCCTCGCCTCGCGGCCCTTACTCCGTCGGCCAAAGTACG
CCTCCAAAGCTGTCACCCGCCCGCCACCACGACGCCCGAGCCTCGAGTCCCAATTACTTTGGCCTCGTCGTCGAC
TCTTCCAACGACACGCGCGAATCCATGGGGCTGGCACGCGAAAACTGGAGTCCTGCCTCGTCCTCGGTCAAGTCT
TTTGCCGCCGCCCTGCCGAAGCAGCTTCCCCTAGAGCCAAATTCCGAGTTTGAGGCCTTTCGACGCCAGGCCGAC
CTGAACTGGTCCAAGCCGTTTGCTCTGCCTGCCGTACCGCACAAGAAGGCCGCCAGTGTCCGCACCCGTCCGCCC
AGACTGTCGACATCGGCTAGCGATGTTTCTTCGGCCCCAGACGCCGCGACCTGCACCAAGATGGATGTCGACCAC
GACACCCAGGCCGACGGCTCTGCCGATGGCAACGTCAGGCCCCCCCCTGTCCCTACGCAAATCACCTCGATGCGC
ATGAGCAGGTCGCCGCAAGGCATGGACTCGCCACGTCGTTCCCCGACGGCATCCGACCTGAACGAAGCCCGCTTG
TCTCTGGCAATCGACCCTCCAAGGCCATCGTCTCCCGGACCGGTCGAGACGGGCCCCCGTGCCATCACGCTTCCT
CCCAAGCTGGACGGCGGCGGCCCGTCCATGATATCAGACACCTGCCTCAAAGAGCTTATGGAATCGATAGCCGAT
GACCAACTCCTAGTGCTGGATATTCGATCCCTGCAGAGTTTCGCCCAGTCTCGCATCAGGGGCGCGCTGAATCTC
TGCATCCCCACAACGCTGCTCAAGCGGCCTAATTTTAACATTGAAAAGTTGCAGCAGACGTTTCAGGGCGGCGCG
GCATCGGACAAGTTTGCCGACTGGCGGCGCATGTCGTGGATCATCGTGTACGACGCGCACGGCTGGGAGAGCCGC
GAGGCCGTAACGGCGCAGAACATGATTAAGAAGTTTACAAACGAGGGCTTCAAAGGCGAGACGGCTATCCTGCGC
GGCGGCTTTGGCGTCTTTCACAAATCCTATCCCCATCTCGTCGACGACGGTTCGACCACGCCGGCCGCGGCCCAC
GGAGGGCGTAATGGCCGCGGCAACGGAGGCTTGGCGCCCGTCATCGGCGGCGTCAATCTCCCGGCCTCTACCAGC
GAGGTGGATCCCTTCTTCTCTAATATCCGGCAGAACGTCGATCTCGCCGATGGCGTGGGACAGATGGAGGTCACG
CGGCCGTCGGGCTTGGATTCGCCCTTGCTTCCGCAGTGGTTGCGCGAGGCGGCCTCGAAGATTGATCGCGGCCGG
CGCGTGGCCGATAAGTTTTTGCGCATCGAGCTCGACGAGCAGGCTCGGATGCGCAGCGCGTATGCGGCCTTTCAA
CCTGGCGCTCAAGGACGAGCCCGGATTCAGCTATCGGGCGTCGAGAAGGGCAGCAAGAACCGATACAAAGATATC
TTACCGTTTGAGCACGCCCGTGTGCGGCTGCAGAGCAAGCCGGCCGGCTCGTGCGACTATGTCAACGCCAGCCAC
CTCGGGGCGTCTAGAAGCCACAAGCGGTACATTGCTTCGCAGGGCCCCTTGCCGGCCACGTTTGAGGTGAGCAGC
GCGGGCGACACAACAGGGACACGGGGCTAAGCATGCTGACTTGGAGCAGGACTTTTGGTCCGTTATCTGGGAACA
AGACGTGCGTGTCATTGTCATGCTGACGGCCGAGACGGAGGGCGGGCAGCTCAAGTGCCATCCGTACTGGAAGGG
CAGGGAGTTTGGGCCCATCAGGCTTCGGCCTCTGTCGGAGAAGAGGGCGTTGCTGGACATGGACAAGCACCGAGG
CGACACGTGCGCAGCCTGCTCTGCTGCCGAGTTTGGCCGGAAGCGGGCGAATACGACGACGACTCTCGAGGCGGC
GGCGACGCCCGGCTGCGCCAGCTGCCAGGGTCAGGGTCAGGGTCAGGGGCAGTCCGAGGCGCCGTACGTGGTGAT
CCGCAAGTTCGCACTGGCGCACATGGCGCACCCGTTCGCGTCTATGCGCGAGATCACGCACCTGCACTTCCCGGC
GTGGCCCGACTTTGGGACGCCGGCCAAGGCGTCGCACCTCCTGGCGCTGGTGGAGCTGGCGAACCTGATGCACCG
GGCAGCGCGTCCCGTGGAGACGACGACGCTGGTGTCGGACGACTACGTGCCGGCTTCTTGGTACGACGAGCCGGA
GAACGAGGCTCAGCCGCGGCCGATGATGGTGCACTGCTCGGCCGGCTGCGGGCGGACGGGGACTTTTTGCGCCGT
CGACAGCGTTATCGACATGCTGAAGCGGCAGCGGCAGGCCAAGCTGGCGGCGGCGCGGGACGGGTGCGGCGGCGT
GGATGCCGACGACGAGGCCATATCGCCGCGCAGCGTGGTCCAGGGGCCGTTGCCCGGTACCACTCCGGCTCCGGG
AACGGCCGGACCGGAAGCGGCATGGGTCCGTGACGAGACGGAGGACTTGATCCAGGCGACGGTGCAAGACTTTCG
CGAGCAGAGGCTCAGCATGGTGCAGAGCTTGCGGCAGTACGTGCTGTGCTACGAGACGATTGTCGAATGGGTGCA
CCGCGTCAACGAGAGAGCGGCCGGAGGACGGCTGCGGAGCGGGAGTCTGCAGCAGCCACGTCGGAACAATCAGCG
CAACAAGGGTTATGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail