Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03691
Gene name
Locationscaffold_03:3555298..3558869
Strand-
Gene length (bp)3571
Transcript length (bp)3453
Coding sequence length (bp)3453
Protein length (aa) 1151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 7.0E-09 548 662
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 4.1E-15 960 1107
PF03733 YccF Inner membrane component domain 4.9E-16 276 329

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 284 306 22
2 421 443 22
3 447 464 17
4 515 534 19
5 544 566 22
6 579 601 22
7 611 633 22
8 645 667 22
9 716 738 22
10 959 978 19
11 993 1015 22
12 1028 1050 22
13 1065 1087 22
14 1094 1116 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03691
MDREHPRRSKSPPSDPASPTDSRPPPELRVELPDEGGLSESLQSGDTVRRRVTEGIGYGSIHSSVASSSRPPPLD
TSQDRPQPRSAASTPRPSTTSAPDRLKSFTRQRKPILPRRISSNTPHRGEIFSADDDTHEVEADAVSRQRDLPSG
YGTRRRTQLSSTLRLPSYRAAEAEPEAEPNRGVPPTTTEEDEDGESPDQEQESPLEEHVDCDSSSDLSDAESFTL
KDRQQAINQTHPFGIRVWKPALYKKDRSIQKTAQADIHSTPGGHVSRWLLLFNLVWTLCFGWWMAVLAAFGAVVC
LLFAAAPSGREYGRILWGLAGYLFYPFGKFVRLEKDEAYLHEDAHEGRSVSEYEQWQSGDLEYGRLFFGPDRSRS
IVGRSRRSLDSEPSETESLLGRGRRGESRSANVTGRRQRLFGRGEWNIGRVIFFIFFWCLISPSLIVVSAICWFL
VFWIPMGKVTILLFDHLRRHPLALSFESHVRYTRAEDAPDSSILLCTYRAVGSKYWKYTVDGTNIFLINLMAVVC
FVIFDWLVLDRSLHLDNHITSPAFLFTASLLSIIPLAYFIGQAVASISAQSSMGLGAAVNAFFATVVEVFLYCVA
LGQGKGQLVEGSIIGSIFAGVLFLPGISMCFGAIKRKTQRFNAKSAGVTSTMLLFAAVGAFSPTLFYQIHGTHEL
NCLECDDSNPGGSRGSKRTEDCRRCFFSQLPALDNRFYLEAVRPYCYLAAAMLFLSYLIGLWFTLRTHAAVIWNA
EVEEKRHEEHLQVSVLKSAQPHPAVETTGADIRDSQLYKRILGQSLRQAGLPSTSDDGQRRSSAVSQEAAKAAAA
PANGSAAAAAAAPTMTPHVVPPRGNDSGRPAVHVPGLSAAENTALAREVAEIAATAATIASRERFTRRLSTVPTG
STVGSRGHAPAPRAGVVHEVGVEDAMTAAAAAAAADTATAHGGGHGGHDAPNWGRTKSSVILLGATVLYAVIAEI
LVDTVDVVLESFSIDQKFLGITLFALVPNTTEFLNAISFAMNGNIALSMEIGSAYALQVCLLQIPCLVLFSALYP
STAPGEDAMMYSFSLLFPQWDMVTVILCVFLLSNVYGEGKSNYFKGSILLLTYLVVITGYFFSGYTTDVMGSART
DLMKDGRWQSFKTVGRMGRGEAFPV*
Coding >Ophcf2|03691
ATGGATCGAGAGCACCCTCGTCGTTCAAAGTCGCCACCTTCCGACCCGGCGTCGCCTACCGATTCCCGTCCTCCG
CCCGAGCTGAGGGTCGAGCTCCCCGATGAAGGAGGCCTTTCGGAGAGTTTGCAGTCGGGCGATACCGTGAGGCGT
CGCGTCACCGAAGGCATTGGATACGGCTCCATACATTCGTCAGTGGCCAGCTCCAGTCGGCCTCCGCCTCTCGAC
ACGTCGCAGGATCGCCCGCAACCCAGGAGCGCTGCCTCGACGCCGCGTCCGAGCACTACCTCGGCGCCCGATCGC
CTCAAGTCCTTTACCCGTCAGCGGAAACCCATCTTGCCGCGCCGCATATCCTCCAACACGCCGCACCGGGGCGAA
ATCTTCTCCGCCGACGATGACACCCACGAGGTCGAGGCCGATGCCGTCAGCCGTCAGCGAGATCTTCCCTCTGGT
TACGGCACCCGCCGTCGCACCCAGTTGTCGTCGACCCTTCGTCTTCCATCGTATCGCGCCGCCGAAGCCGAGCCC
GAAGCCGAGCCGAACCGCGGCGTGCCGCCCACGACGACAGAGGAGGACGAGGACGGAGAGAGCCCCGATCAGGAA
CAGGAGTCGCCGCTCGAGGAGCACGTCGACTGCGACTCTAGCAGTGACCTGAGCGACGCCGAGAGCTTCACCCTC
AAGGACCGACAGCAGGCCATCAACCAGACGCATCCCTTCGGCATCCGCGTCTGGAAGCCCGCCCTTTACAAAAAG
GATCGGTCGATCCAGAAGACGGCGCAGGCAGACATCCACTCCACCCCTGGCGGTCACGTCAGTCGCTGGCTGCTG
CTCTTCAACCTCGTCTGGACCCTGTGCTTCGGCTGGTGGATGGCCGTGCTGGCCGCCTTTGGTGCCGTCGTCTGC
CTCCTTTTCGCCGCCGCACCGAGCGGCAGGGAGTACGGCCGCATCCTCTGGGGACTGGCCGGCTATCTGTTTTAC
CCCTTTGGCAAGTTTGTGAGGCTGGAAAAGGACGAGGCCTACCTGCACGAGGATGCGCACGAGGGCCGGAGCGTT
TCCGAGTACGAGCAATGGCAGAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGACCGCAGCCGCTCC
ATCGTCGGCCGCTCCCGCCGGAGCCTCGATTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGCCGCGGCCGACGA
GGCGAGTCCCGCTCGGCCAACGTCACGGGTAGGCGCCAGAGGCTTTTTGGTCGCGGCGAGTGGAATATTGGCCGC
GTCATCTTCTTCATCTTCTTCTGGTGCCTCATCTCGCCCTCGCTCATCGTCGTATCCGCCATCTGCTGGTTCCTC
GTCTTCTGGATTCCCATGGGCAAGGTCACCATCCTCCTCTTCGACCACCTGAGGCGCCACCCGCTGGCGCTGTCG
TTTGAGTCGCACGTCCGCTACACGCGCGCCGAGGACGCGCCCGACTCGTCCATTTTGCTCTGCACCTATCGCGCC
GTCGGCTCAAAGTATTGGAAGTACACGGTCGACGGCACCAACATCTTCCTCATTAACCTCATGGCCGTTGTCTGC
TTCGTCATCTTCGATTGGCTCGTCCTGGATCGATCTCTGCACCTCGACAATCATATCACCTCCCCGGCTTTCCTC
TTCACCGCGTCCCTGCTCTCCATCATTCCGCTGGCCTACTTCATCGGGCAGGCCGTGGCATCCATCTCGGCCCAG
TCGTCGATGGGCCTGGGCGCCGCCGTCAACGCCTTCTTCGCCACTGTCGTCGAGGTCTTTCTCTATTGCGTCGCC
CTCGGTCAGGGCAAGGGCCAACTCGTCGAGGGGAGCATCATAGGCAGCATCTTCGCCGGCGTGCTCTTCCTCCCG
GGCATTTCCATGTGCTTCGGCGCCATCAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCCGGCGTCACGTCG
ACCATGCTGCTGTTCGCCGCCGTCGGCGCCTTTAGCCCGACGCTTTTCTACCAGATCCACGGCACCCACGAGCTC
AACTGCCTCGAATGCGATGACTCGAACCCGGGCGGCAGCCGCGGCTCGAAGAGGACCGAAGACTGCCGACGCTGC
TTCTTCTCGCAATTGCCGGCTCTGGACAACCGGTTTTACCTCGAGGCTGTGCGGCCCTACTGCTACCTGGCGGCG
GCCATGCTGTTTCTGTCGTACCTGATTGGGCTGTGGTTCACGCTGCGGACGCATGCCGCCGTCATCTGGAACGCC
GAGGTGGAAGAGAAGAGGCACGAAGAGCACCTCCAGGTGTCTGTGCTTAAGAGCGCGCAGCCGCATCCGGCCGTC
GAGACGACGGGTGCCGACATCCGCGACTCGCAGCTGTACAAGCGCATCCTGGGCCAGTCGCTGCGGCAGGCCGGT
CTGCCATCAACGTCTGACGACGGGCAGCGACGGTCGTCGGCCGTGTCCCAGGAAGCTGCCAAGGCGGCGGCAGCG
CCGGCTAACGGATCGGCAGCGGCGGCGGCAGCGGCGCCGACGATGACGCCACACGTGGTGCCTCCCCGAGGCAAC
GACTCGGGGCGGCCGGCGGTGCATGTGCCGGGCCTCAGCGCGGCGGAGAACACGGCGCTAGCGCGCGAGGTGGCT
GAGATTGCGGCGACGGCGGCAACGATAGCATCGCGCGAGCGCTTCACGCGCAGGCTGTCGACGGTTCCCACCGGT
TCGACGGTTGGTTCACGCGGTCACGCGCCGGCGCCGCGAGCCGGAGTCGTGCACGAAGTCGGGGTCGAGGATGCC
ATGACGGCGGCGGCGGCTGCGGCGGCTGCGGATACGGCAACGGCCCACGGCGGAGGCCACGGCGGTCACGACGCG
CCCAACTGGGGGCGGACCAAGAGCTCCGTCATCCTCCTAGGGGCCACGGTGCTATACGCCGTCATCGCCGAGATC
CTGGTGGACACGGTCGACGTCGTGCTGGAGAGCTTCTCCATCGACCAAAAGTTTCTCGGCATCACGCTGTTTGCC
CTGGTGCCCAACACGACCGAATTCCTGAATGCCATCTCGTTCGCCATGAACGGCAACATCGCACTCTCGATGGAG
ATTGGTTCGGCCTACGCACTTCAGGTTTGCCTGCTTCAGATCCCCTGCCTGGTGCTCTTTTCGGCGCTGTATCCG
AGCACGGCGCCAGGCGAGGATGCCATGATGTACTCGTTTTCGCTGCTGTTTCCGCAGTGGGACATGGTGACGGTC
ATCCTCTGCGTCTTTCTTCTGAGCAACGTGTACGGTGAAGGCAAGAGCAACTACTTCAAGGGCAGCATCCTGCTG
CTGACGTATCTGGTCGTCATCACGGGCTACTTTTTCAGCGGCTACACGACGGACGTGATGGGCTCGGCGAGGACG
GACTTGATGAAGGATGGACGTTGGCAGTCGTTCAAGACGGTTGGGAGGATGGGGAGAGGAGAGGCCTTTCCAGTG
TGA
Transcript >Ophcf2|03691
ATGGATCGAGAGCACCCTCGTCGTTCAAAGTCGCCACCTTCCGACCCGGCGTCGCCTACCGATTCCCGTCCTCCG
CCCGAGCTGAGGGTCGAGCTCCCCGATGAAGGAGGCCTTTCGGAGAGTTTGCAGTCGGGCGATACCGTGAGGCGT
CGCGTCACCGAAGGCATTGGATACGGCTCCATACATTCGTCAGTGGCCAGCTCCAGTCGGCCTCCGCCTCTCGAC
ACGTCGCAGGATCGCCCGCAACCCAGGAGCGCTGCCTCGACGCCGCGTCCGAGCACTACCTCGGCGCCCGATCGC
CTCAAGTCCTTTACCCGTCAGCGGAAACCCATCTTGCCGCGCCGCATATCCTCCAACACGCCGCACCGGGGCGAA
ATCTTCTCCGCCGACGATGACACCCACGAGGTCGAGGCCGATGCCGTCAGCCGTCAGCGAGATCTTCCCTCTGGT
TACGGCACCCGCCGTCGCACCCAGTTGTCGTCGACCCTTCGTCTTCCATCGTATCGCGCCGCCGAAGCCGAGCCC
GAAGCCGAGCCGAACCGCGGCGTGCCGCCCACGACGACAGAGGAGGACGAGGACGGAGAGAGCCCCGATCAGGAA
CAGGAGTCGCCGCTCGAGGAGCACGTCGACTGCGACTCTAGCAGTGACCTGAGCGACGCCGAGAGCTTCACCCTC
AAGGACCGACAGCAGGCCATCAACCAGACGCATCCCTTCGGCATCCGCGTCTGGAAGCCCGCCCTTTACAAAAAG
GATCGGTCGATCCAGAAGACGGCGCAGGCAGACATCCACTCCACCCCTGGCGGTCACGTCAGTCGCTGGCTGCTG
CTCTTCAACCTCGTCTGGACCCTGTGCTTCGGCTGGTGGATGGCCGTGCTGGCCGCCTTTGGTGCCGTCGTCTGC
CTCCTTTTCGCCGCCGCACCGAGCGGCAGGGAGTACGGCCGCATCCTCTGGGGACTGGCCGGCTATCTGTTTTAC
CCCTTTGGCAAGTTTGTGAGGCTGGAAAAGGACGAGGCCTACCTGCACGAGGATGCGCACGAGGGCCGGAGCGTT
TCCGAGTACGAGCAATGGCAGAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGACCGCAGCCGCTCC
ATCGTCGGCCGCTCCCGCCGGAGCCTCGATTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGCCGCGGCCGACGA
GGCGAGTCCCGCTCGGCCAACGTCACGGGTAGGCGCCAGAGGCTTTTTGGTCGCGGCGAGTGGAATATTGGCCGC
GTCATCTTCTTCATCTTCTTCTGGTGCCTCATCTCGCCCTCGCTCATCGTCGTATCCGCCATCTGCTGGTTCCTC
GTCTTCTGGATTCCCATGGGCAAGGTCACCATCCTCCTCTTCGACCACCTGAGGCGCCACCCGCTGGCGCTGTCG
TTTGAGTCGCACGTCCGCTACACGCGCGCCGAGGACGCGCCCGACTCGTCCATTTTGCTCTGCACCTATCGCGCC
GTCGGCTCAAAGTATTGGAAGTACACGGTCGACGGCACCAACATCTTCCTCATTAACCTCATGGCCGTTGTCTGC
TTCGTCATCTTCGATTGGCTCGTCCTGGATCGATCTCTGCACCTCGACAATCATATCACCTCCCCGGCTTTCCTC
TTCACCGCGTCCCTGCTCTCCATCATTCCGCTGGCCTACTTCATCGGGCAGGCCGTGGCATCCATCTCGGCCCAG
TCGTCGATGGGCCTGGGCGCCGCCGTCAACGCCTTCTTCGCCACTGTCGTCGAGGTCTTTCTCTATTGCGTCGCC
CTCGGTCAGGGCAAGGGCCAACTCGTCGAGGGGAGCATCATAGGCAGCATCTTCGCCGGCGTGCTCTTCCTCCCG
GGCATTTCCATGTGCTTCGGCGCCATCAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCCGGCGTCACGTCG
ACCATGCTGCTGTTCGCCGCCGTCGGCGCCTTTAGCCCGACGCTTTTCTACCAGATCCACGGCACCCACGAGCTC
AACTGCCTCGAATGCGATGACTCGAACCCGGGCGGCAGCCGCGGCTCGAAGAGGACCGAAGACTGCCGACGCTGC
TTCTTCTCGCAATTGCCGGCTCTGGACAACCGGTTTTACCTCGAGGCTGTGCGGCCCTACTGCTACCTGGCGGCG
GCCATGCTGTTTCTGTCGTACCTGATTGGGCTGTGGTTCACGCTGCGGACGCATGCCGCCGTCATCTGGAACGCC
GAGGTGGAAGAGAAGAGGCACGAAGAGCACCTCCAGGTGTCTGTGCTTAAGAGCGCGCAGCCGCATCCGGCCGTC
GAGACGACGGGTGCCGACATCCGCGACTCGCAGCTGTACAAGCGCATCCTGGGCCAGTCGCTGCGGCAGGCCGGT
CTGCCATCAACGTCTGACGACGGGCAGCGACGGTCGTCGGCCGTGTCCCAGGAAGCTGCCAAGGCGGCGGCAGCG
CCGGCTAACGGATCGGCAGCGGCGGCGGCAGCGGCGCCGACGATGACGCCACACGTGGTGCCTCCCCGAGGCAAC
GACTCGGGGCGGCCGGCGGTGCATGTGCCGGGCCTCAGCGCGGCGGAGAACACGGCGCTAGCGCGCGAGGTGGCT
GAGATTGCGGCGACGGCGGCAACGATAGCATCGCGCGAGCGCTTCACGCGCAGGCTGTCGACGGTTCCCACCGGT
TCGACGGTTGGTTCACGCGGTCACGCGCCGGCGCCGCGAGCCGGAGTCGTGCACGAAGTCGGGGTCGAGGATGCC
ATGACGGCGGCGGCGGCTGCGGCGGCTGCGGATACGGCAACGGCCCACGGCGGAGGCCACGGCGGTCACGACGCG
CCCAACTGGGGGCGGACCAAGAGCTCCGTCATCCTCCTAGGGGCCACGGTGCTATACGCCGTCATCGCCGAGATC
CTGGTGGACACGGTCGACGTCGTGCTGGAGAGCTTCTCCATCGACCAAAAGTTTCTCGGCATCACGCTGTTTGCC
CTGGTGCCCAACACGACCGAATTCCTGAATGCCATCTCGTTCGCCATGAACGGCAACATCGCACTCTCGATGGAG
ATTGGTTCGGCCTACGCACTTCAGGTTTGCCTGCTTCAGATCCCCTGCCTGGTGCTCTTTTCGGCGCTGTATCCG
AGCACGGCGCCAGGCGAGGATGCCATGATGTACTCGTTTTCGCTGCTGTTTCCGCAGTGGGACATGGTGACGGTC
ATCCTCTGCGTCTTTCTTCTGAGCAACGTGTACGGTGAAGGCAAGAGCAACTACTTCAAGGGCAGCATCCTGCTG
CTGACGTATCTGGTCGTCATCACGGGCTACTTTTTCAGCGGCTACACGACGGACGTGATGGGCTCGGCGAGGACG
GACTTGATGAAGGATGGACGTTGGCAGTCGTTCAAGACGGTTGGGAGGATGGGGAGAGGAGAGGCCTTTCCAGTG
TGA
Gene >Ophcf2|03691
ATGGATCGAGAGCACCCTCGTCGTTCAAAGTCGCCACCTTCCGACCCGGCGTCGCCTACCGATTCCCGTCCTCCG
CCCGAGCTGAGGGTCGAGCTCCCCGATGAAGGAGGCCTTTCGGAGAGTTTGCAGTCGGGCGATACCGTGAGGCGT
CGCGTCACCGAAGGCATTGGATACGGTCAGTCTGTAGTCGCTGACGACAAAGGATACGCGTTAAACTCATCGCGA
CTCTCAGGCTCCATACATTCGTCAGTGGCCAGCTCCAGTCGGCCTCCGCCTCTCGACACGTCGCAGGATCGCCCG
CAACCCAGGAGCGCTGCCTCGACGCCGCGTCCGAGCACTACCTCGGCGCCCGATCGCCTCAAGTCCTTTACCCGT
CAGCGGAAACCCATCTTGCCGCGCCGCATATCCTCCAACACGCCGCACCGGGGCGAAATCTTCTCCGCCGACGAT
GACACCCACGAGGTCGAGGCCGATGCCGTCAGCCGTCAGCGAGATCTTCCCTCTGGTTACGGCACCCGCCGTCGC
ACCCAGTTGTCGTCGACCCTTCGTCTTCCATCGTATCGCGCCGCCGAAGCCGAGCCCGAAGCCGAGCCGAACCGC
GGCGTGCCGCCCACGACGACAGAGGAGGACGAGGACGGAGAGAGCCCCGATCAGGAACAGGAGTCGCCGCTCGAG
GAGCACGTCGACTGCGACTCTAGCAGTGACCTGAGCGACGCCGAGAGCTTCACCCTCAAGGACCGACAGCAGGCC
ATCAACCAGACGCATCCCTTCGGCATCCGCGTCTGGAAGCCCGCCCTTTACAAAAAGGATCGGTCGATCCAGAAG
ACGGCGCAGGCAGACATCCACTCCACCCCTGGCGGTCACGTCAGTCGCTGGCTGCTGCTCTTCAACCTCGTCTGG
ACCCTGTGCTTCGGCTGGTGGATGGCCGTGCTGGCCGCCTTTGGTGCCGTCGTCTGCCTCCTTTTCGCCGCCGCA
CCGAGCGGCAGGGAGTACGGCCGCATCCTCTGGGGACTGGCCGGCTATCTGTTTTACCCCTTTGGCAAGTTTGTG
AGGCTGGAAAAGGACGAGGCCTACCTGCACGAGGATGCGCACGAGGGCCGGAGCGTTTCCGAGTACGAGCAATGG
CAGAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGACCGCAGCCGCTCCATCGTCGGCCGCTCCCGC
CGGAGCCTCGATTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGCCGCGGCCGACGAGGCGAGTCCCGCTCGGCC
AACGTCACGGGTAGGCGCCAGAGGCTTTTTGGTCGCGGCGAGTGGAATATTGGCCGCGTCATCTTCTTCATCTTC
TTCTGGTGCCTCATCTCGCCCTCGCTCATCGTCGTATCCGCCATCTGCTGGTTCCTCGTCTTCTGGATTCCCATG
GGCAAGGTCACCATCCTCCTCTTCGACCACCTGAGGCGCCACCCGCTGGCGCTGTCGTTTGAGTCGCACGTCCGC
TACACGCGCGCCGAGGACGCGCCCGACTCGTCCATTTTGCTCTGCACCTATCGCGCCGTCGGCTCAAAGTATTGG
AAGTACACGGTCGACGGCACCAACATCTTCCTCATTAACCTCATGGCCGTTGTCTGCTTCGTCATCTTCGATTGG
CTCGTCCTGGATCGATCTCTGCACCTCGACAATCATATCACCTCCCCGGCTTTCCTCTTCACCGCGTCCCTGCTC
TCCATCATTCCGCTGGCCTACTTCATCGGGCAGGCCGTGGCATCCATCTCGGCCCAGTCGTCGATGGGCCTGGGC
GCCGCCGTCAACGCCTTCTTCGCCACTGTCGTCGAGGTCTTTCTCTATTGCGTCGCCCTCGGTCAGGGCAAGGGC
CAACTCGTCGAGGGGAGCATCATAGGCAGCATCTTCGCCGGCGTGCTCTTCCTCCCGGGCATTTCCATGTGCTTC
GGCGCCATCAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCCGGCGTCACGTCGACCATGCTGCTGTTCGCC
GCCGTCGGCGCCTTTAGCCCGACGCTTTTCTACCAGATCCACGGCACCCACGAGCTCAACTGCCTCGAATGCGAT
GACTCGAACCCGGGCGGCAGCCGCGGCTCGAAGAGGACCGAAGACTGCCGACGCTGCTTCTTCTCGCAATTGCCG
GCTCTGGACAACCGGTTTTACCTCGAGGCTGTGCGGCCCTACTGCTACCTGGCGGCGGCCATGCTGTTTCTGTCG
TACCTGATTGGGCTGTGGTTCACGCTGCGGACGCATGCCGCCGTCATCTGGAACGCCGAGGTGGAAGAGAAGAGG
CACGAAGAGCACCTCCAGGTGTCTGTGCTTAAGAGCGCGCAGCCGCATCCGGCCGTCGAGACGACGGGTGCCGAC
ATCCGCGACTCGCAGCTGTACAAGCGCATCCTGGGCCAGTCGCTGCGGCAGGCCGGTCTGCCATCAACGTCTGAC
GACGGGCAGCGACGGTCGTCGGCCGTGTCCCAGGAAGCTGCCAAGGCGGCGGCAGCGCCGGCTAACGGATCGGCA
GCGGCGGCGGCAGCGGCGCCGACGATGACGCCACACGTGGTGCCTCCCCGAGGCAACGACTCGGGGCGGCCGGCG
GTGCATGTGCCGGGCCTCAGCGCGGCGGAGAACACGGCGCTAGCGCGCGAGGTGGCTGAGATTGCGGCGACGGCG
GCAACGATAGCATCGCGCGAGCGCTTCACGCGCAGGCTGTCGACGGTTCCCACCGGTTCGACGGTTGGTTCACGC
GGTCACGCGCCGGCGCCGCGAGCCGGAGTCGTGCACGAAGTCGGGGTCGAGGATGCCATGACGGCGGCGGCGGCT
GCGGCGGCTGCGGATACGGCAACGGCCCACGGCGGAGGCCACGGCGGTCACGACGCGCCCAACTGGGGGCGGACC
AAGAGCTCCGTCATCCTCCTAGGGGCCACGGTGCTATACGCCGTCATCGCCGAGATCCTGGTGGACACGGTCGAC
GTCGTGCTGGAGAGCTTCTCCATCGACCAAAAGTTTCTCGGCATCACGCTGTTTGCCCTGGTGCCCAACACGACC
GAATTCCTGGTAAGTAGGCTTCGGCCATGGACACGGTGAGAGGTTCGAGCTGACGGTTTGTCCTTTACAGAATGC
CATCTCGTTCGCCATGAACGGCAACATCGCACTCTCGATGGAGATTGGTTCGGCCTACGCACTTCAGGTTTGCCT
GCTTCAGATCCCCTGCCTGGTGCTCTTTTCGGCGCTGTATCCGAGCACGGCGCCAGGCGAGGATGCCATGATGTA
CTCGTTTTCGCTGCTGTTTCCGCAGTGGGACATGGTGACGGTCATCCTCTGCGTCTTTCTTCTGAGCAACGTGTA
CGGTGAAGGCAAGAGCAACTACTTCAAGGGCAGCATCCTGCTGCTGACGTATCTGGTCGTCATCACGGGCTACTT
TTTCAGCGGCTACACGACGGACGTGATGGGCTCGGCGAGGACGGACTTGATGAAGGATGGACGTTGGCAGTCGTT
CAAGACGGTTGGGAGGATGGGGAGAGGAGAGGCCTTTCCAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail