Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03690
Gene name
Locationscaffold_03:3552238..3553696
Strand-
Gene length (bp)1458
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20150 2EXR 2EXR family 1.1E-06 15 136

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5974 0.5451 0.1883 0.1383 0.2295 0.1768 0.1091 0.1332 0.0885 0.0458

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2227
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1829
Ophiocordyceps australis map64 (Brazil) OphauB2|1529
Ophiocordyceps camponoti-floridani Ophcf2|03690 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2358
Ophiocordyceps kimflemingae Ophio5|3180
Ophiocordyceps subramaniannii Hirsu2|2847

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03690
MASIRFDVPDGCRVFTLFPRLPAELRHRIWEAYLCDPGVNFIKLQVWDLYSGAWGRPMVRSPAAEAAAAAADSSA
GEELDDVGRLLLRHDCLPRVSIFSRLVSSYPKNPLADHSQHRELRVRLAAMAGTCVESHSLVRSLMARPGVLRLE
SGLFVSLSRSPDVMLLEYYPHELYKGSGTLNVDIFCPTLDLIRRLAVRYCHAWRPEVKQSWSGCKPYLEDTGNCP
THLYQFLARHLPSLREFYFVDYFIVPKTAEEKGDAMSVDDGDDDDADDDDADDVHIDAIRRRRRRSGINPVFSVR
NRRFHDVSDCDPETCDWKLNRQSLKILDWLRDHFVRYASQSHTSRHKAPEKVYFGLLACEWVIPSPSSSHRHDPP
KPRVRPPNGRRRGTPGGRIEAARVALARASRSTPRTISSSPYAASGPLSRVSGCLVTEPAPTSMYVFGSGRGDDF
KFTFAQPYGGVSRWLEA*
Coding >Ophcf2|03690
ATGGCTAGCATCAGGTTCGACGTGCCCGACGGCTGCCGCGTCTTCACGCTCTTTCCGCGGCTGCCCGCTGAACTG
CGCCACCGCATCTGGGAAGCCTACCTGTGCGACCCGGGCGTCAACTTCATCAAGCTTCAGGTCTGGGACCTCTAT
AGCGGTGCCTGGGGCAGGCCCATGGTTCGCTCTCCCGCCGCAGAGGCAGCGGCTGCGGCAGCTGATTCCTCGGCT
GGCGAGGAACTGGACGACGTGGGCCGACTACTGTTGCGCCACGACTGTCTCCCGCGGGTTTCCATCTTCTCTCGC
CTCGTTTCGAGTTACCCCAAAAACCCGTTGGCCGACCACTCGCAGCACCGCGAGTTGCGTGTCCGGCTGGCCGCC
ATGGCTGGAACCTGCGTCGAGTCCCACAGCCTTGTCCGCAGCCTGATGGCTAGGCCGGGCGTTTTGCGGCTTGAA
TCGGGTCTCTTCGTCTCCCTCAGCCGCTCTCCGGACGTGATGCTCCTCGAATATTACCCTCACGAGCTTTACAAG
GGGTCCGGCACTCTGAATGTCGACATTTTCTGCCCGACACTCGATCTGATTCGCCGCCTCGCCGTTCGCTATTGT
CACGCGTGGAGACCCGAGGTGAAGCAATCCTGGTCCGGATGCAAGCCCTACCTCGAGGATACCGGCAACTGCCCA
ACTCACCTGTATCAGTTCCTCGCCAGGCATCTGCCCAGCCTTCGCGAGTTTTACTTTGTCGACTACTTCATCGTG
CCCAAGACAGCCGAGGAAAAGGGGGACGCCATGTCTGTTGATGATGGTGATGACGACGACGCCGACGACGACGAC
GCCGACGACGTACACATCGACGCCATCCGACGCCGTCGCCGCCGTTCTGGCATCAACCCCGTCTTTAGTGTCCGA
AATCGGCGCTTCCACGACGTCAGCGACTGCGACCCGGAAACCTGCGACTGGAAGTTGAACCGCCAGTCGCTCAAG
ATCTTGGACTGGCTCCGCGACCATTTCGTGCGTTACGCGTCTCAGAGCCACACCAGCCGCCACAAGGCGCCTGAG
AAGGTCTACTTCGGCCTCCTGGCCTGCGAGTGGGTCATTCCCTCGCCCTCGTCCTCCCACCGACACGACCCGCCC
AAGCCCCGAGTCAGGCCGCCGAATGGCCGCCGACGGGGAACGCCCGGTGGAAGGATCGAAGCGGCAAGAGTAGCC
CTTGCCCGTGCTTCACGATCAACTCCTCGGACCATCTCTTCTTCTCCTTATGCTGCTTCCGGGCCGTTAAGCCGG
GTGAGCGGATGTTTGGTGACGGAACCGGCCCCGACCTCAATGTACGTCTTTGGATCCGGCCGCGGGGACGACTTT
AAGTTTACGTTTGCGCAGCCTTATGGGGGGGTTTCGAGGTGGCTTGAAGCGTAG
Transcript >Ophcf2|03690
ATGGCTAGCATCAGGTTCGACGTGCCCGACGGCTGCCGCGTCTTCACGCTCTTTCCGCGGCTGCCCGCTGAACTG
CGCCACCGCATCTGGGAAGCCTACCTGTGCGACCCGGGCGTCAACTTCATCAAGCTTCAGGTCTGGGACCTCTAT
AGCGGTGCCTGGGGCAGGCCCATGGTTCGCTCTCCCGCCGCAGAGGCAGCGGCTGCGGCAGCTGATTCCTCGGCT
GGCGAGGAACTGGACGACGTGGGCCGACTACTGTTGCGCCACGACTGTCTCCCGCGGGTTTCCATCTTCTCTCGC
CTCGTTTCGAGTTACCCCAAAAACCCGTTGGCCGACCACTCGCAGCACCGCGAGTTGCGTGTCCGGCTGGCCGCC
ATGGCTGGAACCTGCGTCGAGTCCCACAGCCTTGTCCGCAGCCTGATGGCTAGGCCGGGCGTTTTGCGGCTTGAA
TCGGGTCTCTTCGTCTCCCTCAGCCGCTCTCCGGACGTGATGCTCCTCGAATATTACCCTCACGAGCTTTACAAG
GGGTCCGGCACTCTGAATGTCGACATTTTCTGCCCGACACTCGATCTGATTCGCCGCCTCGCCGTTCGCTATTGT
CACGCGTGGAGACCCGAGGTGAAGCAATCCTGGTCCGGATGCAAGCCCTACCTCGAGGATACCGGCAACTGCCCA
ACTCACCTGTATCAGTTCCTCGCCAGGCATCTGCCCAGCCTTCGCGAGTTTTACTTTGTCGACTACTTCATCGTG
CCCAAGACAGCCGAGGAAAAGGGGGACGCCATGTCTGTTGATGATGGTGATGACGACGACGCCGACGACGACGAC
GCCGACGACGTACACATCGACGCCATCCGACGCCGTCGCCGCCGTTCTGGCATCAACCCCGTCTTTAGTGTCCGA
AATCGGCGCTTCCACGACGTCAGCGACTGCGACCCGGAAACCTGCGACTGGAAGTTGAACCGCCAGTCGCTCAAG
ATCTTGGACTGGCTCCGCGACCATTTCGTGCGTTACGCGTCTCAGAGCCACACCAGCCGCCACAAGGCGCCTGAG
AAGGTCTACTTCGGCCTCCTGGCCTGCGAGTGGGTCATTCCCTCGCCCTCGTCCTCCCACCGACACGACCCGCCC
AAGCCCCGAGTCAGGCCGCCGAATGGCCGCCGACGGGGAACGCCCGGTGGAAGGATCGAAGCGGCAAGAGTAGCC
CTTGCCCGTGCTTCACGATCAACTCCTCGGACCATCTCTTCTTCTCCTTATGCTGCTTCCGGGCCGTTAAGCCGG
GTGAGCGGATGTTTGGTGACGGAACCGGCCCCGACCTCAATGTACGTCTTTGGATCCGGCCGCGGGGACGACTTT
AAGTTTACGTTTGCGCAGCCTTATGGGGGGGTTTCGAGGTGGCTTGAAGCGTAG
Gene >Ophcf2|03690
ATGGCTAGCATCAGGTTCGACGTGCCCGACGGCTGCCGCGTCTTCACGCTCTTTCCGCGGCTGCCCGCTGAACTG
CGCCACCGCATCTGGGAAGCCTACCTGTGCGACCCGGGCGTCAACTTCATCAAGCTTCAGGTCTGGGACCTCTAT
AGCGGTGCCTGGGGCAGGCCCATGGTTCGCTCTCCCGCCGCAGAGGCAGCGGCTGCGGCAGCTGATTCCTCGGCT
GGCGAGGAACTGGACGACGTGGGCCGACTACTGTTGCGCCACGACTGTCTCCCGCGGGTTTCCATCTTCTCTCGC
CTCGTTTCGAGTTACCCCAAAAACCCGTTGGCCGACCACTCGCAGCACCGCGAGTTGCGTGTCCGGCTGGCCGCC
ATGGCTGGAACCTGCGTCGAGTCCCACAGCCTTGTCCGCAGCCTGATGGCTAGGCCGGGCGTTTTGCGGCTTGAA
TCGGGTCTCTTCGTCTCCCTCAGCCGCTCTCCGGACGTGATGCTCCTCGAATATTACCCTCACGAGCTTTACAAG
GGGTCCGGCACTCTGAATGTCGACATTTTCTGCCCGACACTCGATCTGATTCGCCGCCTCGCCGTTCGCTATTGT
CACGCGTGGAGACCCGAGGTGAAGCAATCCTGGTCCGGATGCAAGCCCTACCTCGAGGATACCGGCAACTGCCCA
ACTCACCTGTATCAGTTCCTCGCCAGGCATCTGCCCAGCCTTCGCGAGTTTTACTTTGTCGACTACTTCATCGTG
CCCAAGACAGCCGAGGAAAAGGGGGACGCCATGTCTGTTGATGATGGTGATGACGACGACGCCGACGACGACGAC
GCCGACGACGTACACATCGACGCCATCCGACGCCGTCGCCGCCGTTCTGGTGAGTGTCTTCCGTCCAATTCGCGT
CGGTCATGAAGCTGACGGCGATAATTAGGCATCAACCCCGTCTTTAGTGTCCGAAATCGGCGCTTCCACGACGTC
AGCGACTGCGACCCGGAAACCTGCGACTGGAAGTTGAACCGCCAGTCGCTCAAGATCTTGGACTGGCTCCGCGAC
CATTTCGTGCGTTACGCGTCTCAGAGCCACACCAGCCGCCACAAGGCGCCTGAGAAGGTCTACTTCGGCCTCCTG
GCCTGCGAGTGGGTCATTCCCTCGCCCTCGTCCTCCCACCGACACGACCCGCCCAAGCCCCGAGTCAGGCCGCCG
AATGGCCGCCGACGGGGAACGCCCGGTGGAAGGATCGAAGCGGCAAGAGTAGCCCTTGCCCGTGCTTCACGATCA
ACTCCTCGGACCATCTCTTCTTCTCCTTATGCTGCTTCCGGGCCGTTAAGCCGGGTGAGCGGATGTTTGGTGACG
GAACCGGCCCCGACCTCAATGTACGTCTTTGGATCCGGCCGCGGGGACGACTTTAAGTTTACGTTTGCGCAGCCT
TATGGGGGGGTTTCGAGGTGGCTTGAAGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail