Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03682
Gene name
Locationscaffold_03:3519181..3522494
Strand-
Gene length (bp)3313
Transcript length (bp)3255
Coding sequence length (bp)3255
Protein length (aa) 1085

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12090 Spt20 Spt20 family 3.8E-39 126 383

GO

GO Term Description Terminal node
GO:0003712 transcription coregulator activity Yes
GO:0000124 SAGA complex Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0031248 protein acetyltransferase complex No
GO:1902494 catalytic complex No
GO:0070461 SAGA-type complex No
GO:0140110 transcription regulator activity No
GO:0032991 protein-containing complex No
GO:1905368 peptidase complex No
GO:0000123 histone acetyltransferase complex No
GO:0140535 intracellular protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:1990234 transferase complex No
GO:1902493 acetyltransferase complex No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1988 0.9386 0.171 0.0096 0.062 0.001 0.0112 0.005 0.0084 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5287
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4810
Ophiocordyceps australis map64 (Brazil) OphauB2|1521
Ophiocordyceps camponoti-floridani Ophcf2|03682 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4225
Ophiocordyceps kimflemingae Ophio5|6081
Ophiocordyceps subramaniannii Hirsu2|4717

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03682
MASSSPVVQQNGGSAKIKRPAPLGIPANGILPSASSPSPSMASAKKPPLSAMQPPNSAGDRSITASTVRPVNRAR
REASSQASGRPSRNSAGIRSASLLADNAAQTLEPLPYNVSEDVILKKHAGQPPSLVVHLHSTHFRFEGQDGVFPY
KSPMRIFIEHLRRKTIPHDLLDYFIKANVPFYSGRLIVQVHDYKSSAQPKDANKSSPKSSSSAVVPSSIHNYNQC
MTPSPYVPFPKEGQAGVNEPSKGEMEAKKLGEGRRNDGGMPAPSVPLDGSKARTASQPKVFTIVLHPTQESLQTD
LRIKANTPKGAVDGRSDVVPPSTPLTLVPPTPTASNMPPPAKRPKREKMELDASDIHVAEGQILLATAPPLYLKP
TKSAEETIALFDILASSMHSEPPPQPKTRKRTIAEMAADEAAAAEQERYMLVLDDRLASAPGSQAANGADGDVQT
GVATFEPRFERFKVLDEIRREQAEKREQEKIKQQEIDRRAQLQRQQEAMQRQQAEAEKSRREAAAAAANAARDNQ
MRQAEAQRQAMAARAASNPPNNPNQHGQVVQPGVPSGGMPNGVHQNGMPNGMQGQAQPRFPPQMAQPSASSPVIR
QGTPQQPQNMSSPMTGSVPMQQANSGMAASPPRPPSVVQNHQMAVPMAHNMSARGSQQSHPSGTPRIPHSTPIIT
HGTPVNRPAMVATPRMSQASPPPNMMAQNSQMGQAAMMMNAQGMNQHNPQAFVQMAAQRAMTQQQHQQQQQQQQQ
MAAMQNGMAGQGMSPQAQQQMMQMMHRQMLMQQQQQAQQQAQQHPQQHPQHPQQQHPQHPHQQHPQGGMLTPQQQ
QQLAAQYAQQLQAMQGRQMSPQMQAQLQQLARMGTPIGNPMQRQISSQMMNGSPANMQALAAMQMQQQQQQQQQQ
QQQQQQQQQQAQQQQAQQQHQQQQQQQQQQQQHQLPQQQQQHQSQQHQQPQQPGMPPQMGVNAIQVQMQTYARQN
YSKLLQGAMAKYGAFENIPAEAIEKMKQTSFAQAQLLIQRNMTQRRVQQQMIMQQQAQQQAQQQAQQQAQQQQAQ
QQQQAQQHTPQQHTPQQQQAALQGMGGIMGHQGM*
Coding >Ophcf2|03682
ATGGCTTCCAGCAGCCCCGTTGTTCAGCAGAATGGCGGTTCTGCCAAGATCAAACGTCCCGCTCCTTTGGGAATC
CCGGCAAATGGCATCTTGCCGTCCGCATCCTCGCCCTCGCCCTCGATGGCTTCAGCTAAGAAGCCGCCGCTGAGC
GCCATGCAGCCCCCCAACTCTGCCGGCGACCGATCCATCACCGCCTCTACTGTCCGGCCTGTCAACCGCGCTCGT
CGGGAAGCCTCATCTCAAGCGTCTGGGAGGCCGTCAAGAAATAGTGCCGGTATCCGCTCAGCCTCGCTGCTTGCC
GACAACGCCGCCCAGACCCTAGAACCTCTACCTTATAATGTATCCGAAGACGTCATCCTCAAGAAGCATGCCGGC
CAGCCTCCCTCTCTCGTTGTGCACCTGCACTCGACTCACTTCCGCTTCGAAGGCCAGGACGGCGTTTTCCCCTAC
AAGTCACCGATGCGCATCTTCATCGAACACCTACGCCGCAAAACTATTCCCCACGACCTTCTCGACTACTTCATC
AAGGCCAACGTTCCCTTCTACAGCGGCCGTCTGATTGTACAGGTTCACGACTACAAGTCGTCAGCCCAGCCCAAG
GATGCAAACAAATCCTCGCCCAAGTCGTCATCCAGTGCCGTGGTGCCGTCATCGATCCACAACTATAATCAGTGC
ATGACGCCGTCGCCCTACGTGCCGTTCCCGAAAGAGGGCCAGGCCGGTGTCAACGAACCCTCCAAAGGGGAGATG
GAGGCGAAGAAGCTGGGAGAGGGCCGGAGAAACGACGGAGGCATGCCCGCCCCGAGCGTCCCCCTGGACGGCTCG
AAGGCAAGGACCGCGTCTCAGCCCAAGGTTTTCACCATCGTGCTTCACCCAACCCAGGAGAGCCTTCAGACCGAT
CTGCGCATCAAGGCCAACACGCCCAAGGGAGCTGTCGATGGGCGTTCTGACGTGGTTCCGCCTTCGACGCCCTTG
ACGTTGGTGCCTCCGACCCCGACGGCTTCCAACATGCCGCCGCCGGCGAAACGACCTAAGAGGGAGAAGATGGAG
TTGGACGCGAGCGATATCCACGTCGCCGAGGGCCAGATTCTACTGGCCACGGCGCCGCCGCTCTACCTGAAGCCG
ACCAAGAGCGCCGAAGAGACCATTGCCCTGTTTGACATCCTGGCCTCGTCCATGCATTCCGAGCCCCCGCCTCAG
CCCAAGACGCGGAAAAGGACCATCGCCGAGATGGCAGCCGACGAGGCCGCCGCCGCGGAACAGGAACGCTACATG
CTGGTCTTGGACGATAGATTGGCCAGTGCTCCGGGTTCTCAGGCAGCAAACGGAGCCGACGGGGATGTGCAAACA
GGGGTGGCTACTTTTGAGCCTCGCTTCGAACGGTTCAAGGTCCTCGACGAGATCAGGAGAGAGCAAGCCGAGAAG
AGGGAGCAGGAGAAGATCAAGCAGCAAGAGATCGACCGAAGGGCTCAACTACAGAGGCAGCAGGAGGCCATGCAA
CGACAGCAGGCAGAGGCAGAAAAGTCTCGTCGTGAAGCCGCTGCCGCCGCCGCAAACGCAGCCAGGGACAACCAG
ATGCGACAGGCCGAGGCTCAGCGGCAGGCCATGGCGGCACGGGCGGCGTCGAACCCTCCCAATAACCCGAATCAG
CACGGCCAGGTCGTCCAGCCCGGCGTCCCGTCCGGAGGCATGCCCAACGGCGTCCATCAGAATGGGATGCCCAAC
GGCATGCAGGGCCAGGCACAGCCGAGGTTCCCGCCACAGATGGCACAGCCTTCAGCCTCGTCGCCGGTGATCCGT
CAAGGCACCCCTCAGCAGCCGCAGAACATGTCGTCGCCCATGACGGGCAGCGTTCCCATGCAGCAGGCCAACTCG
GGCATGGCGGCGAGTCCGCCTAGGCCTCCATCGGTGGTTCAGAACCACCAGATGGCGGTCCCGATGGCCCACAAC
ATGTCAGCCAGGGGCAGCCAACAGAGCCATCCTTCGGGCACGCCTCGGATACCGCACTCGACACCCATCATAACC
CACGGGACGCCCGTCAACCGGCCCGCCATGGTGGCCACTCCTCGCATGAGCCAGGCCAGCCCGCCTCCTAACATG
ATGGCCCAGAACTCGCAGATGGGGCAGGCGGCCATGATGATGAATGCCCAGGGCATGAACCAGCACAACCCCCAG
GCATTCGTTCAGATGGCAGCTCAACGCGCCATGACCCAGCAACAACATCAACAGCAACAACAGCAGCAGCAGCAA
ATGGCAGCCATGCAGAACGGCATGGCCGGTCAGGGGATGTCGCCTCAGGCTCAACAACAGATGATGCAGATGATG
CACCGCCAGATGCTCATGCAGCAGCAGCAACAGGCTCAGCAACAAGCCCAACAACATCCCCAGCAGCATCCTCAG
CACCCACAGCAACAGCATCCTCAGCATCCTCACCAACAACACCCTCAGGGCGGCATGCTGACGCCCCAGCAGCAA
CAGCAGCTCGCGGCCCAGTACGCCCAGCAGCTTCAGGCGATGCAAGGCAGGCAGATGAGTCCCCAGATGCAGGCG
CAGTTGCAGCAATTGGCCCGGATGGGCACTCCGATAGGGAACCCGATGCAGAGGCAGATCAGCAGCCAGATGATG
AACGGTTCCCCTGCCAACATGCAAGCTCTCGCGGCGATGCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAACAACAACAGCAACAGCAACAGGCTCAACAACAGCAGGCACAGCAGCAGCATCAGCAACAACAGCAA
CAGCAGCAACAGCAGCAACAGCATCAACTCCCGCAGCAGCAGCAACAGCATCAGTCCCAGCAACATCAGCAACCC
CAACAGCCCGGCATGCCACCACAGATGGGCGTTAACGCCATCCAGGTCCAGATGCAAACCTATGCCCGTCAGAAC
TACTCCAAGTTGCTGCAGGGCGCCATGGCCAAATACGGCGCGTTCGAGAACATCCCGGCAGAAGCCATCGAGAAG
ATGAAGCAGACGTCCTTTGCTCAGGCGCAGCTCCTGATTCAGCGTAACATGACTCAGCGAAGGGTGCAGCAGCAG
ATGATCATGCAGCAGCAGGCTCAGCAGCAGGCTCAGCAGCAGGCTCAGCAGCAGGCCCAGCAGCAGCAGGCCCAG
CAGCAGCAGCAGGCCCAGCAGCACACGCCGCAGCAGCACACGCCACAGCAGCAGCAGGCTGCCCTGCAAGGGATG
GGCGGCATCATGGGGCATCAGGGCATGTAG
Transcript >Ophcf2|03682
ATGGCTTCCAGCAGCCCCGTTGTTCAGCAGAATGGCGGTTCTGCCAAGATCAAACGTCCCGCTCCTTTGGGAATC
CCGGCAAATGGCATCTTGCCGTCCGCATCCTCGCCCTCGCCCTCGATGGCTTCAGCTAAGAAGCCGCCGCTGAGC
GCCATGCAGCCCCCCAACTCTGCCGGCGACCGATCCATCACCGCCTCTACTGTCCGGCCTGTCAACCGCGCTCGT
CGGGAAGCCTCATCTCAAGCGTCTGGGAGGCCGTCAAGAAATAGTGCCGGTATCCGCTCAGCCTCGCTGCTTGCC
GACAACGCCGCCCAGACCCTAGAACCTCTACCTTATAATGTATCCGAAGACGTCATCCTCAAGAAGCATGCCGGC
CAGCCTCCCTCTCTCGTTGTGCACCTGCACTCGACTCACTTCCGCTTCGAAGGCCAGGACGGCGTTTTCCCCTAC
AAGTCACCGATGCGCATCTTCATCGAACACCTACGCCGCAAAACTATTCCCCACGACCTTCTCGACTACTTCATC
AAGGCCAACGTTCCCTTCTACAGCGGCCGTCTGATTGTACAGGTTCACGACTACAAGTCGTCAGCCCAGCCCAAG
GATGCAAACAAATCCTCGCCCAAGTCGTCATCCAGTGCCGTGGTGCCGTCATCGATCCACAACTATAATCAGTGC
ATGACGCCGTCGCCCTACGTGCCGTTCCCGAAAGAGGGCCAGGCCGGTGTCAACGAACCCTCCAAAGGGGAGATG
GAGGCGAAGAAGCTGGGAGAGGGCCGGAGAAACGACGGAGGCATGCCCGCCCCGAGCGTCCCCCTGGACGGCTCG
AAGGCAAGGACCGCGTCTCAGCCCAAGGTTTTCACCATCGTGCTTCACCCAACCCAGGAGAGCCTTCAGACCGAT
CTGCGCATCAAGGCCAACACGCCCAAGGGAGCTGTCGATGGGCGTTCTGACGTGGTTCCGCCTTCGACGCCCTTG
ACGTTGGTGCCTCCGACCCCGACGGCTTCCAACATGCCGCCGCCGGCGAAACGACCTAAGAGGGAGAAGATGGAG
TTGGACGCGAGCGATATCCACGTCGCCGAGGGCCAGATTCTACTGGCCACGGCGCCGCCGCTCTACCTGAAGCCG
ACCAAGAGCGCCGAAGAGACCATTGCCCTGTTTGACATCCTGGCCTCGTCCATGCATTCCGAGCCCCCGCCTCAG
CCCAAGACGCGGAAAAGGACCATCGCCGAGATGGCAGCCGACGAGGCCGCCGCCGCGGAACAGGAACGCTACATG
CTGGTCTTGGACGATAGATTGGCCAGTGCTCCGGGTTCTCAGGCAGCAAACGGAGCCGACGGGGATGTGCAAACA
GGGGTGGCTACTTTTGAGCCTCGCTTCGAACGGTTCAAGGTCCTCGACGAGATCAGGAGAGAGCAAGCCGAGAAG
AGGGAGCAGGAGAAGATCAAGCAGCAAGAGATCGACCGAAGGGCTCAACTACAGAGGCAGCAGGAGGCCATGCAA
CGACAGCAGGCAGAGGCAGAAAAGTCTCGTCGTGAAGCCGCTGCCGCCGCCGCAAACGCAGCCAGGGACAACCAG
ATGCGACAGGCCGAGGCTCAGCGGCAGGCCATGGCGGCACGGGCGGCGTCGAACCCTCCCAATAACCCGAATCAG
CACGGCCAGGTCGTCCAGCCCGGCGTCCCGTCCGGAGGCATGCCCAACGGCGTCCATCAGAATGGGATGCCCAAC
GGCATGCAGGGCCAGGCACAGCCGAGGTTCCCGCCACAGATGGCACAGCCTTCAGCCTCGTCGCCGGTGATCCGT
CAAGGCACCCCTCAGCAGCCGCAGAACATGTCGTCGCCCATGACGGGCAGCGTTCCCATGCAGCAGGCCAACTCG
GGCATGGCGGCGAGTCCGCCTAGGCCTCCATCGGTGGTTCAGAACCACCAGATGGCGGTCCCGATGGCCCACAAC
ATGTCAGCCAGGGGCAGCCAACAGAGCCATCCTTCGGGCACGCCTCGGATACCGCACTCGACACCCATCATAACC
CACGGGACGCCCGTCAACCGGCCCGCCATGGTGGCCACTCCTCGCATGAGCCAGGCCAGCCCGCCTCCTAACATG
ATGGCCCAGAACTCGCAGATGGGGCAGGCGGCCATGATGATGAATGCCCAGGGCATGAACCAGCACAACCCCCAG
GCATTCGTTCAGATGGCAGCTCAACGCGCCATGACCCAGCAACAACATCAACAGCAACAACAGCAGCAGCAGCAA
ATGGCAGCCATGCAGAACGGCATGGCCGGTCAGGGGATGTCGCCTCAGGCTCAACAACAGATGATGCAGATGATG
CACCGCCAGATGCTCATGCAGCAGCAGCAACAGGCTCAGCAACAAGCCCAACAACATCCCCAGCAGCATCCTCAG
CACCCACAGCAACAGCATCCTCAGCATCCTCACCAACAACACCCTCAGGGCGGCATGCTGACGCCCCAGCAGCAA
CAGCAGCTCGCGGCCCAGTACGCCCAGCAGCTTCAGGCGATGCAAGGCAGGCAGATGAGTCCCCAGATGCAGGCG
CAGTTGCAGCAATTGGCCCGGATGGGCACTCCGATAGGGAACCCGATGCAGAGGCAGATCAGCAGCCAGATGATG
AACGGTTCCCCTGCCAACATGCAAGCTCTCGCGGCGATGCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAACAACAACAGCAACAGCAACAGGCTCAACAACAGCAGGCACAGCAGCAGCATCAGCAACAACAGCAA
CAGCAGCAACAGCAGCAACAGCATCAACTCCCGCAGCAGCAGCAACAGCATCAGTCCCAGCAACATCAGCAACCC
CAACAGCCCGGCATGCCACCACAGATGGGCGTTAACGCCATCCAGGTCCAGATGCAAACCTATGCCCGTCAGAAC
TACTCCAAGTTGCTGCAGGGCGCCATGGCCAAATACGGCGCGTTCGAGAACATCCCGGCAGAAGCCATCGAGAAG
ATGAAGCAGACGTCCTTTGCTCAGGCGCAGCTCCTGATTCAGCGTAACATGACTCAGCGAAGGGTGCAGCAGCAG
ATGATCATGCAGCAGCAGGCTCAGCAGCAGGCTCAGCAGCAGGCTCAGCAGCAGGCCCAGCAGCAGCAGGCCCAG
CAGCAGCAGCAGGCCCAGCAGCACACGCCGCAGCAGCACACGCCACAGCAGCAGCAGGCTGCCCTGCAAGGGATG
GGCGGCATCATGGGGCATCAGGGCATGTAG
Gene >Ophcf2|03682
ATGGCTTCCAGCAGCCCCGTTGTTCAGCAGAATGGCGGTTCTGCCAAGATCAAACGTCCCGCTCCTTTGGGAATC
CCGGCAAATGGCATCTTGCCGTCCGCATCCTCGCCCTCGCCCTCGATGGCTTCAGCTAAGAAGCCGCCGCTGAGC
GCCATGCAGCCCCCCAACTCTGCCGGCGACCGATCCATCACCGCCTCTACTGTCCGGCCTGTCAACCGCGCTCGT
CGGGAAGCCTCATCTCAAGCGTCTGGGAGGCCGTCAAGAAATAGTGCCGGTATCCGCTCAGCCTCGCTGCTTGCC
GACAACGCCGCCCAGACCCTAGAACCTCTACCTTATAGTATGATTCTCGCTCACTCCCATTCATCTTGTGTAGAA
CGCTGACACGGCCTCCCTAGATGTATCCGAAGACGTCATCCTCAAGAAGCATGCCGGCCAGCCTCCCTCTCTCGT
TGTGCACCTGCACTCGACTCACTTCCGCTTCGAAGGCCAGGACGGCGTTTTCCCCTACAAGTCACCGATGCGCAT
CTTCATCGAACACCTACGCCGCAAAACTATTCCCCACGACCTTCTCGACTACTTCATCAAGGCCAACGTTCCCTT
CTACAGCGGCCGTCTGATTGTACAGGTTCACGACTACAAGTCGTCAGCCCAGCCCAAGGATGCAAACAAATCCTC
GCCCAAGTCGTCATCCAGTGCCGTGGTGCCGTCATCGATCCACAACTATAATCAGTGCATGACGCCGTCGCCCTA
CGTGCCGTTCCCGAAAGAGGGCCAGGCCGGTGTCAACGAACCCTCCAAAGGGGAGATGGAGGCGAAGAAGCTGGG
AGAGGGCCGGAGAAACGACGGAGGCATGCCCGCCCCGAGCGTCCCCCTGGACGGCTCGAAGGCAAGGACCGCGTC
TCAGCCCAAGGTTTTCACCATCGTGCTTCACCCAACCCAGGAGAGCCTTCAGACCGATCTGCGCATCAAGGCCAA
CACGCCCAAGGGAGCTGTCGATGGGCGTTCTGACGTGGTTCCGCCTTCGACGCCCTTGACGTTGGTGCCTCCGAC
CCCGACGGCTTCCAACATGCCGCCGCCGGCGAAACGACCTAAGAGGGAGAAGATGGAGTTGGACGCGAGCGATAT
CCACGTCGCCGAGGGCCAGATTCTACTGGCCACGGCGCCGCCGCTCTACCTGAAGCCGACCAAGAGCGCCGAAGA
GACCATTGCCCTGTTTGACATCCTGGCCTCGTCCATGCATTCCGAGCCCCCGCCTCAGCCCAAGACGCGGAAAAG
GACCATCGCCGAGATGGCAGCCGACGAGGCCGCCGCCGCGGAACAGGAACGCTACATGCTGGTCTTGGACGATAG
ATTGGCCAGTGCTCCGGGTTCTCAGGCAGCAAACGGAGCCGACGGGGATGTGCAAACAGGGGTGGCTACTTTTGA
GCCTCGCTTCGAACGGTTCAAGGTCCTCGACGAGATCAGGAGAGAGCAAGCCGAGAAGAGGGAGCAGGAGAAGAT
CAAGCAGCAAGAGATCGACCGAAGGGCTCAACTACAGAGGCAGCAGGAGGCCATGCAACGACAGCAGGCAGAGGC
AGAAAAGTCTCGTCGTGAAGCCGCTGCCGCCGCCGCAAACGCAGCCAGGGACAACCAGATGCGACAGGCCGAGGC
TCAGCGGCAGGCCATGGCGGCACGGGCGGCGTCGAACCCTCCCAATAACCCGAATCAGCACGGCCAGGTCGTCCA
GCCCGGCGTCCCGTCCGGAGGCATGCCCAACGGCGTCCATCAGAATGGGATGCCCAACGGCATGCAGGGCCAGGC
ACAGCCGAGGTTCCCGCCACAGATGGCACAGCCTTCAGCCTCGTCGCCGGTGATCCGTCAAGGCACCCCTCAGCA
GCCGCAGAACATGTCGTCGCCCATGACGGGCAGCGTTCCCATGCAGCAGGCCAACTCGGGCATGGCGGCGAGTCC
GCCTAGGCCTCCATCGGTGGTTCAGAACCACCAGATGGCGGTCCCGATGGCCCACAACATGTCAGCCAGGGGCAG
CCAACAGAGCCATCCTTCGGGCACGCCTCGGATACCGCACTCGACACCCATCATAACCCACGGGACGCCCGTCAA
CCGGCCCGCCATGGTGGCCACTCCTCGCATGAGCCAGGCCAGCCCGCCTCCTAACATGATGGCCCAGAACTCGCA
GATGGGGCAGGCGGCCATGATGATGAATGCCCAGGGCATGAACCAGCACAACCCCCAGGCATTCGTTCAGATGGC
AGCTCAACGCGCCATGACCCAGCAACAACATCAACAGCAACAACAGCAGCAGCAGCAAATGGCAGCCATGCAGAA
CGGCATGGCCGGTCAGGGGATGTCGCCTCAGGCTCAACAACAGATGATGCAGATGATGCACCGCCAGATGCTCAT
GCAGCAGCAGCAACAGGCTCAGCAACAAGCCCAACAACATCCCCAGCAGCATCCTCAGCACCCACAGCAACAGCA
TCCTCAGCATCCTCACCAACAACACCCTCAGGGCGGCATGCTGACGCCCCAGCAGCAACAGCAGCTCGCGGCCCA
GTACGCCCAGCAGCTTCAGGCGATGCAAGGCAGGCAGATGAGTCCCCAGATGCAGGCGCAGTTGCAGCAATTGGC
CCGGATGGGCACTCCGATAGGGAACCCGATGCAGAGGCAGATCAGCAGCCAGATGATGAACGGTTCCCCTGCCAA
CATGCAAGCTCTCGCGGCGATGCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACA
GCAACAGCAACAGGCTCAACAACAGCAGGCACAGCAGCAGCATCAGCAACAACAGCAACAGCAGCAACAGCAGCA
ACAGCATCAACTCCCGCAGCAGCAGCAACAGCATCAGTCCCAGCAACATCAGCAACCCCAACAGCCCGGCATGCC
ACCACAGATGGGCGTTAACGCCATCCAGGTCCAGATGCAAACCTATGCCCGTCAGAACTACTCCAAGTTGCTGCA
GGGCGCCATGGCCAAATACGGCGCGTTCGAGAACATCCCGGCAGAAGCCATCGAGAAGATGAAGCAGACGTCCTT
TGCTCAGGCGCAGCTCCTGATTCAGCGTAACATGACTCAGCGAAGGGTGCAGCAGCAGATGATCATGCAGCAGCA
GGCTCAGCAGCAGGCTCAGCAGCAGGCTCAGCAGCAGGCCCAGCAGCAGCAGGCCCAGCAGCAGCAGCAGGCCCA
GCAGCACACGCCGCAGCAGCACACGCCACAGCAGCAGCAGGCTGCCCTGCAAGGGATGGGCGGCATCATGGGGCA
TCAGGGCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail