Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03668
Gene name
Locationscaffold_03:3478232..3480214
Strand+
Gene length (bp)1982
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08631 SPO22 Meiosis protein SPO22/ZIP4 like 6.2E-49 5 278

GO

GO Term Description Terminal node
GO:0051321 meiotic cell cycle Yes
GO:0007049 cell cycle No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0022414 reproductive process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7223 0.5656 0.217 0.1418 0.0655 0.0108 0.1833 0.2348 0.3072 0.0101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2754
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7399
Ophiocordyceps australis map64 (Brazil) OphauB2|3416
Ophiocordyceps camponoti-floridani Ophcf2|03668 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|318
Ophiocordyceps kimflemingae Ophio5|765
Ophiocordyceps subramaniannii Hirsu2|4362

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03668
MRMTLSWREDRLDVAEHMFGKTEMLRRHMDTPAAEVMADALRHIGADLSSKGNHTLALQWLRRAHDLIDGQSPEN
LSTHGLELRLAICHGRVQSLLAVDSAESLQEANDIVAYVESELGDKPIVLHWRLEILQKSPDDVMGAEARASILR
RMVRCFDRSDDGLDFLLHQFTELSRCCGRLALGLLDELFRRHLLTSANLVWIGKGVVRRTWMVTMVEGDGEVLGS
LRGVMDEAFDALSGPLKPDAAGAVHSLLWNKAEALFGGQQFTTADGWCEVGLHELLSSAGEANAGKFGRKRILCA
LKLNDADRAKQAYDQMSSGPQHDSLTSYLMFKVSLLSWDHELGCRSVARLGANSGTVRGRDMLYACVREAQQFGD
RVCAVAALRAVAKGWEVGPVVAEGLPAVLRCMIRLMCLNGEEEEAEEEEAEKRDEFAAETCAVFEKAAEHARHNP
RDSEGKKVFTVSELDWFRKNAYNLGVKKCDSWPLTDVMRLFRVCLALVESYPPDIASSHAAECQTMALRSHFICA
TASTSLARSSSSPSSESGERRKHYGNARAHISAFEALMIKEGGKEAEEKAATLAVLHFEAAAWEGAWGICRGL*
Coding >Ophcf2|03668
ATGCGGATGACGTTGTCGTGGAGAGAGGATCGACTTGACGTTGCCGAGCACATGTTTGGCAAGACGGAGATGCTT
CGTCGACACATGGATACGCCTGCGGCTGAGGTCATGGCAGATGCCCTGCGACATATCGGTGCTGACTTGTCGTCC
AAGGGGAACCACACGCTGGCACTGCAGTGGCTGAGGAGGGCGCACGATCTCATTGATGGTCAGAGCCCGGAGAAT
CTGTCGACGCACGGGCTCGAGCTCCGGTTAGCCATATGTCACGGCCGCGTTCAGAGTCTGCTCGCCGTCGACTCG
GCCGAGAGTCTCCAGGAGGCCAACGATATCGTGGCCTACGTCGAGTCCGAGCTCGGAGATAAGCCCATCGTGTTG
CATTGGCGTCTGGAGATTCTGCAAAAGTCGCCTGACGACGTCATGGGCGCCGAGGCGCGGGCCAGTATCCTGAGG
CGAATGGTGCGCTGCTTCGATCGGTCTGACGATGGGCTCGATTTTTTACTCCATCAGTTTACGGAGCTGAGTCGC
TGCTGTGGGAGGTTGGCCTTGGGACTGCTGGATGAGCTGTTCAGACGGCATCTTTTGACGTCTGCTAATTTGGTC
TGGATCGGTAAGGGGGTGGTCAGGCGGACTTGGATGGTGACGATGGTGGAGGGCGATGGGGAGGTGCTGGGGTCG
TTGAGGGGGGTTATGGATGAGGCGTTTGATGCTCTTTCGGGGCCGTTGAAGCCGGACGCGGCCGGAGCAGTGCAT
TCGCTTCTATGGAACAAGGCCGAGGCCCTGTTTGGCGGTCAGCAGTTTACGACGGCGGATGGCTGGTGTGAGGTC
GGACTCCACGAGCTCCTTTCCAGCGCGGGCGAGGCCAATGCCGGCAAGTTCGGAAGGAAGCGCATTCTCTGCGCC
CTCAAGCTCAACGACGCGGATCGAGCCAAGCAGGCGTACGACCAGATGTCCTCGGGCCCGCAACACGATAGCCTA
ACCAGCTACCTCATGTTCAAGGTCTCGCTGCTAAGCTGGGACCACGAGCTCGGATGCCGGAGCGTGGCCCGTCTC
GGGGCGAATTCCGGGACGGTACGGGGCCGCGACATGCTATACGCTTGCGTACGGGAGGCGCAGCAGTTTGGGGAT
CGGGTTTGCGCTGTTGCTGCGCTGAGGGCTGTTGCGAAGGGGTGGGAGGTTGGGCCGGTTGTTGCGGAGGGATTG
CCGGCTGTGTTGCGGTGTATGATTCGGCTCATGTGCTTGAACGGGGAGGAGGAGGAAGCGGAAGAGGAGGAGGCG
GAGAAGAGGGATGAATTTGCGGCTGAGACGTGTGCTGTTTTCGAGAAGGCGGCTGAGCACGCCAGGCACAACCCT
CGAGACTCTGAGGGGAAGAAGGTGTTTACCGTCTCGGAACTGGATTGGTTTCGCAAGAACGCGTATAACCTTGGT
GTCAAGAAGTGCGACTCCTGGCCGCTAACAGACGTGATGCGCCTTTTCAGAGTCTGTCTAGCCCTTGTTGAAAGC
TACCCCCCAGACATAGCATCCTCCCACGCAGCAGAGTGTCAAACGATGGCCTTACGAAGCCACTTCATCTGCGCC
ACGGCCAGTACCTCCCTCGCCCGCTCCTCCTCCTCTCCCTCATCGGAGAGCGGAGAGCGAAGAAAGCACTACGGC
AATGCCCGAGCCCACATCTCGGCCTTTGAAGCCCTGATGATCAAGGAGGGTGGGAAAGAGGCCGAGGAGAAGGCG
GCCACGCTGGCGGTTTTGCACTTTGAGGCTGCGGCTTGGGAGGGGGCTTGGGGGATCTGCCGGGGATTGTGA
Transcript >Ophcf2|03668
ATGCGGATGACGTTGTCGTGGAGAGAGGATCGACTTGACGTTGCCGAGCACATGTTTGGCAAGACGGAGATGCTT
CGTCGACACATGGATACGCCTGCGGCTGAGGTCATGGCAGATGCCCTGCGACATATCGGTGCTGACTTGTCGTCC
AAGGGGAACCACACGCTGGCACTGCAGTGGCTGAGGAGGGCGCACGATCTCATTGATGGTCAGAGCCCGGAGAAT
CTGTCGACGCACGGGCTCGAGCTCCGGTTAGCCATATGTCACGGCCGCGTTCAGAGTCTGCTCGCCGTCGACTCG
GCCGAGAGTCTCCAGGAGGCCAACGATATCGTGGCCTACGTCGAGTCCGAGCTCGGAGATAAGCCCATCGTGTTG
CATTGGCGTCTGGAGATTCTGCAAAAGTCGCCTGACGACGTCATGGGCGCCGAGGCGCGGGCCAGTATCCTGAGG
CGAATGGTGCGCTGCTTCGATCGGTCTGACGATGGGCTCGATTTTTTACTCCATCAGTTTACGGAGCTGAGTCGC
TGCTGTGGGAGGTTGGCCTTGGGACTGCTGGATGAGCTGTTCAGACGGCATCTTTTGACGTCTGCTAATTTGGTC
TGGATCGGTAAGGGGGTGGTCAGGCGGACTTGGATGGTGACGATGGTGGAGGGCGATGGGGAGGTGCTGGGGTCG
TTGAGGGGGGTTATGGATGAGGCGTTTGATGCTCTTTCGGGGCCGTTGAAGCCGGACGCGGCCGGAGCAGTGCAT
TCGCTTCTATGGAACAAGGCCGAGGCCCTGTTTGGCGGTCAGCAGTTTACGACGGCGGATGGCTGGTGTGAGGTC
GGACTCCACGAGCTCCTTTCCAGCGCGGGCGAGGCCAATGCCGGCAAGTTCGGAAGGAAGCGCATTCTCTGCGCC
CTCAAGCTCAACGACGCGGATCGAGCCAAGCAGGCGTACGACCAGATGTCCTCGGGCCCGCAACACGATAGCCTA
ACCAGCTACCTCATGTTCAAGGTCTCGCTGCTAAGCTGGGACCACGAGCTCGGATGCCGGAGCGTGGCCCGTCTC
GGGGCGAATTCCGGGACGGTACGGGGCCGCGACATGCTATACGCTTGCGTACGGGAGGCGCAGCAGTTTGGGGAT
CGGGTTTGCGCTGTTGCTGCGCTGAGGGCTGTTGCGAAGGGGTGGGAGGTTGGGCCGGTTGTTGCGGAGGGATTG
CCGGCTGTGTTGCGGTGTATGATTCGGCTCATGTGCTTGAACGGGGAGGAGGAGGAAGCGGAAGAGGAGGAGGCG
GAGAAGAGGGATGAATTTGCGGCTGAGACGTGTGCTGTTTTCGAGAAGGCGGCTGAGCACGCCAGGCACAACCCT
CGAGACTCTGAGGGGAAGAAGGTGTTTACCGTCTCGGAACTGGATTGGTTTCGCAAGAACGCGTATAACCTTGGT
GTCAAGAAGTGCGACTCCTGGCCGCTAACAGACGTGATGCGCCTTTTCAGAGTCTGTCTAGCCCTTGTTGAAAGC
TACCCCCCAGACATAGCATCCTCCCACGCAGCAGAGTGTCAAACGATGGCCTTACGAAGCCACTTCATCTGCGCC
ACGGCCAGTACCTCCCTCGCCCGCTCCTCCTCCTCTCCCTCATCGGAGAGCGGAGAGCGAAGAAAGCACTACGGC
AATGCCCGAGCCCACATCTCGGCCTTTGAAGCCCTGATGATCAAGGAGGGTGGGAAAGAGGCCGAGGAGAAGGCG
GCCACGCTGGCGGTTTTGCACTTTGAGGCTGCGGCTTGGGAGGGGGCTTGGGGGATCTGCCGGGGATTGTGA
Gene >Ophcf2|03668
ATGCGGATGACGTTGGTGAGCGATCTGACTGTTGGATTTGCGGGATAGAGGCTGACGAAGCGATGGGGTTTAGTC
GTGGAGAGAGGATCGACTTGACGTTGCCGAGCACATGTTTGGCAAGACGGAGATGCTTCGTCGACACATGGATAC
GCCTGCGGCTGAGGTCATGGCAGATGCCCTGCGACATATCGGTGCTGACTTGTCGTCCAAGGGGAACCACACGCT
GGCACTGCAGTGGCTGAGGAGGGCGCACGATCTCATTGATGGTCAGAGCCCGGAGAATCTGTCGACGCACGGGCT
CGAGCTCCGGTTAGCCATATGTCACGGCCGCGTTCAGAGTCTGCTCGCCGTCGACTCGGCCGAGAGTCTCCAGGA
GGCCAACGATATCGTGGCCTACGTCGAGTCCGAGCTCGGAGATAAGCCCATCGTGTTGCATTGGCGTCTGGAGAT
TCTGCAAAAGTCGCCTGACGACGTCATGGGCGCCGAGGCGCGGGCCAGTATCCTGAGGCGAATGGTGCGCTGCTT
CGATCGGTCTGACGATGGGCTCGATTTTTTACTCCATCAGTTTACGGAGCTGAGTCGCTGCTGTGGGAGGTTGGC
CTTGGGACTGCTGGATGAGCTGTTCAGACGGCATCTTTTGACGTCTGCTAATTTGGTCTGGATCGGTAAGGGGGT
GGTCAGGCGGACTTGGATGGTGACGATGGTGGAGGGCGATGGGGAGGTGCTGGGGTCGTTGAGGGGGGTTATGGA
TGAGGCGTTTGATGCTCTTTCGGGGCCGTTGAAGCCGGACGCGGCCGGAGCAGTGCATTCGGTATGTTGTCCGAA
GAGGAAGAGATGAAGCTGTTGACTGACGTGTTGGGGGAGCAGCTTCTATGGAACAAGGCCGAGGCCCTGTTTGGC
GGTCAGCAGTTTACGACGGCGGATGGCTGGTGTGAGGTCGGACTCCACGAGCTCCTTTCCAGCGCGGGCGAGGCC
AATGCCGGCAAGTTCGGAAGGAAGCGCATTCTCTGCGCCCTCAAGCTCAACGACGCGGATCGAGCCAAGCAGGCG
TACGACCAGATGTCCTCGGGCCCGCAACACGATAGCCTAACCAGCTACCTCATGTTCAAGGTCTCGCTGCTAAGC
TGGGACCACGAGCTCGGATGCCGGAGCGTGGCCCGTCTCGGGGCGAATTCCGGGACGGTACGGGGCCGCGACATG
CTATACGCTTGCGTACGGGAGGCGCAGCAGTTTGGGGATCGGGTTTGCGCTGTTGCTGCGCTGAGGGCTGTTGCG
AAGGGGTGGGAGGTTGGGCCGGTTGTTGCGGAGGGATTGCCGGCTGTGTTGCGGTGTATGATTCGGCTCATGTGC
TTGAACGGGGAGGAGGAGGAAGCGGAAGAGGAGGAGGCGGAGAAGAGGGATGAATTTGCGGCTGAGACGTGTGCT
GTTTTCGAGAAGGGTAGGTATCTTTTCTTCTCTTTCTCTCTTCTTTCTCTCTGCTTGTTCTTACCAGCTGACGAG
GTGTTTCAGCGGCTGAGCACGCCAGGCACAACCCTCGAGACTCTGAGGGGAAGAAGGTGTTTACCGTCTCGGAAC
TGGATTGGTTTCGCAAGAACGCGTATAACCTTGGTGTCAAGAAGTGCGACTCCTGGCCGCTAACAGACGTGATGC
GCCTTTTCAGAGTCTGTCTAGCCCTTGTTGAAAGCTACCCCCCAGACATAGCATCCTCCCACGCAGCAGAGTGTC
AAACGATGGCCTTACGAAGCCACTTCATCTGCGCCACGGCCAGTACCTCCCTCGCCCGCTCCTCCTCCTCTCCCT
CATCGGAGAGCGGAGAGCGAAGAAAGCACTACGGCAATGCCCGAGCCCACATCTCGGCCTTTGAAGCCCTGATGA
TCAAGGAGGGTGGGAAAGAGGCCGAGGAGAAGGCGGCCACGCTGGCGGTTTTGCACTTTGAGGCTGCGGCTTGGG
AGGGGGCTTGGGGGATCTGCCGGGGATTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail