Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03663
Gene name
Locationscaffold_03:3460565..3467104
Strand+
Gene length (bp)6539
Transcript length (bp)5259
Coding sequence length (bp)5259
Protein length (aa) 1753

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02373 JmjC JmjC domain, hydroxylase 8.9E-38 409 526
PF00069 Pkinase Protein kinase domain 6.0E-31 1450 1715
PF13832 zf-HC5HC2H_2 PHD-zinc-finger like domain 5.4E-21 634 733
PF13771 zf-HC5HC2H PHD-like zinc-binding domain 1.5E-19 657 755
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.5E-13 1483 1631
PF02375 JmjN jmjN domain 6.9E-12 108 141

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0036211 protein modification process No
GO:0009987 cellular process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0043412 macromolecule modification No
GO:0006793 phosphorus metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016310 phosphorylation No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5562 0.7627 0.132 0.0367 0.1438 0.0929 0.0532 0.0196 0.0607 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3406
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5345
Ophiocordyceps australis map64 (Brazil) OphauB2|3412
Ophiocordyceps camponoti-floridani Ophcf2|03663 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5744
Ophiocordyceps kimflemingae Ophio5|771
Ophiocordyceps subramaniannii Hirsu2|6377

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03663
MSAAEPVVGPGPGPASGPQPGPQDKTECAKQPPLAFLHSPPDSNEAAKSDASDSELSDLEDEPVLDGPPPVPLEP
AIKRETLEPPTETAPPAEELGEVLPDSWSGAVPVFRPTARQFSDFQWFMKQVDSYGMKSGIIKIIPPTEWKDAQP
PLDDLVKYIKVREPIKQDIMGSNGTYRQVNILHGRSYNLPQWRQLCEQSEHQPPARRGERRANADKPKPPPRSRP
SLGSKTAKPSTPKKRGKAKSNKTRGKQAQNEEEDRPITPVSPKEDFQDEPVNSIEKDAADNGDDADNQDCQPAVG
RMGAIRQPKAKTQSVSARRKYSRREGSAMIDEAAFKDFDYRIDGTEYTPERCEELERAYWKTLTYAPPLYGADMM
GTLFDDRTPTWNLNKLPNLLDVLGTKVPGVNTAYLYLGMWKATFAWHLEDVDLYSINYLHFGAPKQWYSISQADA
RRFEAAMKNIWPADAKACDQFLRHKSFLISPHHLLQHYGIKVNRVVSYPGEFVVTYPYGYHSGYNLGYNCAEAVN
FALESWLDMGKIAKRCECAQAQDSVWVNVYEIERKLRGEETEYDETEDDDDDGDGDDADTAGLPTPPAGLGVRFK
DAGRKRKRALSGVKRPKIKVKRIKLRLKAKVEPPCCLCPHDVPGLAMLPTDDGRKAHRMCALYVPETYIDDVDGK
EIVCNVSGIHKDRLDLKCLFCRSKRGASFQCSKKKCARAYHATCAAAAGVFVEEQDVPVIGEDGTEFKEQAFEFS
CRFHRTRRDKKKDGDALEADEEVRTAAAALVCGEIRQFQYGKGEIFAGMVVENRPEEQTVLLDVMPIGDRIEVEW
KWLLLPDPSDFHLPKASAKAVPLPSSRKAKDQLNAKRFNDRPRKDDVFGDGFTWAEFQLQPVANAEQAKVDFAKP
DQIWHYLGKKSTDARAQYTEDPKKCQHNPRANFMDTIPKPPKPPPPPPLPRSNALQPVSAVAPMAYPHAAVARPE
KPYVYKPRKPIKPQLAPLMYVPQRPGPLPGTAATNPPYHPSYPAVAPAPQSGDVTARVGSQNGPRHGLPPPGRSA
PAHGLQALQARPPAAVAPMPVPIPARVCVPGIQRPVQGTQPKSGTAPQARPSWQVHSSVYPRYPFFQVNHNRDAS
KYRSPYAPWGGFTNGYEYLMPRQSDLLRRPMPRPQVPAGPGSGYPLPQDVARHSGPANMVPAPAAPPASAPVMAP
PMGMDGGILPPPMLGVSGRPPHPAIKPEYGLTLPQTGQQQQLQQQPPPPQYQHPHQNQHQHQHQHQHQHQHQPQP
QPQLQQPRPGVTPAPKSYKVGLPTAISLALKSTKPAVQTPPRESPVPLPANFLAAMASTPGSQQASSSPKPVSQS
QSPGLQALSTQASSLQAPSMQPHKAMMLPPPGFWTKQPITINLDRRYWLAATPSSEGWDNAGQIQQQIGLDPARW
TEEDEGWSAWAHRGITPAAYKCGPCLGQGGSAIVYKVCRVEDGKVLAGKVPRGEGSGRLEAEARLIRPLNHPNVL
KLVAWHEDSALLVTEFCAYDTLQTRIDSGWPSAGRIEIASAMRQLCSAVAYLHGQGLFHTDVKPRNVLVRGLKPL
DLVLGDCGDALPISGKVDRLRGTLSFYSPEMWEYAKHHGPSDDIWALGLTLLSMMQQLPRLRDSGKDDDKDDDDD
DGGLPRKQRRKKAQQKAEDEIKRFPGRCSKHAGDLRSLNPGDGLVLLAERMLAMDCGHRVSAVEAEKEAEEEAAR
LLAEGPWDGGPGLQIKAPENFQPVSFW*
Coding >Ophcf2|03663
ATGTCCGCTGCCGAGCCCGTCGTCGGGCCTGGCCCTGGCCCTGCTTCTGGTCCTCAGCCCGGTCCCCAGGACAAG
ACGGAGTGCGCCAAACAGCCGCCGCTCGCCTTTCTTCATTCGCCGCCCGATAGCAACGAAGCGGCCAAGTCGGAT
GCCAGCGACTCGGAGCTCAGCGACCTCGAAGACGAGCCAGTTCTCGATGGACCTCCTCCTGTCCCTCTTGAGCCT
GCGATCAAGCGCGAGACCCTTGAACCACCGACAGAGACGGCGCCGCCTGCCGAAGAGCTGGGCGAGGTTCTGCCG
GACTCTTGGTCAGGCGCCGTGCCCGTGTTTCGCCCTACAGCGCGTCAGTTCAGCGACTTTCAGTGGTTTATGAAG
CAGGTCGACAGTTACGGCATGAAATCCGGCATCATCAAGATCATCCCGCCAACGGAATGGAAAGATGCTCAGCCG
CCCCTCGACGACCTCGTCAAGTACATCAAGGTTCGCGAGCCCATCAAGCAAGACATCATGGGCTCCAACGGCACC
TACCGACAAGTCAACATCCTCCACGGCCGCTCTTACAATCTGCCTCAGTGGCGACAGCTTTGCGAGCAGAGTGAG
CACCAGCCGCCAGCCAGGCGCGGTGAGCGACGCGCCAATGCCGACAAACCGAAGCCGCCGCCCCGCTCCCGTCCG
TCTCTGGGCTCCAAGACTGCCAAGCCCTCGACTCCCAAGAAGCGTGGCAAGGCGAAATCCAACAAGACTCGGGGC
AAGCAGGCCCAGAATGAGGAAGAAGATCGACCAATCACTCCCGTGTCCCCCAAGGAAGATTTTCAGGACGAACCC
GTCAACTCCATCGAGAAAGACGCTGCCGATAACGGTGATGACGCCGATAATCAAGACTGTCAACCTGCCGTAGGC
CGCATGGGCGCCATCAGGCAGCCCAAGGCCAAGACGCAGTCTGTCTCGGCCCGCCGCAAGTATAGCCGTCGCGAG
GGATCGGCCATGATCGACGAGGCAGCCTTCAAGGACTTTGACTACCGCATCGACGGCACCGAGTACACGCCCGAG
CGCTGCGAGGAGCTTGAGCGTGCCTATTGGAAGACTCTCACCTACGCGCCGCCCCTTTACGGCGCCGACATGATG
GGCACACTGTTCGATGACAGGACGCCCACCTGGAATCTCAACAAGCTGCCCAATCTTCTCGACGTGCTAGGCACC
AAGGTTCCGGGCGTCAACACGGCCTACCTATATCTAGGCATGTGGAAGGCCACTTTTGCCTGGCATCTCGAGGAC
GTGGACCTGTACAGCATCAACTACCTCCATTTCGGAGCTCCGAAGCAGTGGTACAGCATTTCCCAGGCCGACGCC
CGCCGTTTCGAGGCAGCCATGAAGAATATCTGGCCGGCCGATGCCAAGGCTTGCGACCAATTCCTCCGCCACAAG
AGCTTCCTGATCTCGCCGCATCACCTGCTGCAGCATTACGGCATCAAGGTCAACAGGGTCGTGTCGTATCCCGGC
GAGTTCGTCGTTACTTACCCCTATGGGTACCACTCCGGCTATAACTTGGGCTATAACTGTGCCGAAGCAGTCAAC
TTTGCCCTCGAGTCCTGGCTGGACATGGGCAAGATTGCAAAGAGGTGCGAATGCGCCCAGGCCCAGGACAGCGTC
TGGGTCAACGTGTACGAGATCGAGCGCAAGCTTCGTGGCGAAGAGACCGAATATGATGAGACTGAAGACGATGAC
GATGACGGCGATGGCGACGACGCAGACACGGCTGGCCTTCCGACGCCGCCGGCCGGACTCGGCGTGAGATTCAAA
GACGCTGGCCGTAAGAGGAAGCGCGCCCTCTCCGGGGTGAAGCGGCCCAAGATCAAGGTCAAGAGGATCAAGCTG
CGTCTCAAGGCCAAGGTCGAACCTCCTTGCTGCCTTTGCCCGCACGACGTGCCGGGACTTGCCATGCTTCCGACG
GACGATGGCCGGAAAGCACATCGCATGTGCGCGCTGTATGTTCCCGAGACGTACATTGACGACGTCGACGGCAAG
GAGATTGTGTGCAACGTGTCGGGTATTCACAAGGACCGCCTCGATCTCAAGTGCCTCTTCTGCCGCTCCAAGCGC
GGCGCCAGCTTTCAATGCTCCAAGAAGAAATGCGCCAGAGCGTACCACGCGACGTGCGCTGCGGCTGCGGGCGTC
TTCGTGGAGGAGCAAGACGTGCCGGTCATTGGAGAGGACGGAACCGAGTTCAAGGAGCAGGCCTTTGAGTTTAGC
TGTCGCTTCCATCGGACCAGGCGTGACAAGAAGAAGGATGGCGATGCCCTCGAGGCAGACGAGGAGGTCCGGACA
GCGGCCGCGGCCTTGGTTTGTGGAGAAATTCGCCAGTTCCAGTACGGCAAAGGCGAGATCTTTGCTGGCATGGTT
GTCGAGAACCGGCCGGAGGAGCAAACGGTTCTGCTCGACGTGATGCCGATTGGTGATCGTATCGAGGTCGAGTGG
AAGTGGCTGTTGCTTCCAGACCCGTCCGACTTCCATCTGCCCAAGGCATCAGCCAAAGCCGTGCCCCTGCCCTCG
TCGCGCAAGGCCAAGGATCAGCTGAACGCTAAGCGGTTCAACGACCGGCCGAGGAAAGACGACGTTTTTGGCGAC
GGATTCACCTGGGCCGAGTTCCAGCTCCAACCGGTCGCCAACGCGGAGCAGGCCAAGGTCGACTTCGCAAAACCA
GATCAGATATGGCACTATCTCGGCAAGAAGTCAACGGACGCGCGGGCGCAGTACACTGAGGACCCGAAGAAGTGT
CAGCACAACCCTCGAGCCAACTTCATGGACACGATCCCGAAGCCGCCGAAGCCGCCGCCGCCGCCGCCGCTGCCT
AGAAGCAACGCTCTTCAGCCCGTCAGTGCCGTTGCTCCGATGGCGTACCCGCACGCCGCCGTGGCGCGACCCGAG
AAGCCATACGTATACAAGCCTAGGAAGCCCATTAAGCCGCAGCTCGCCCCTCTCATGTACGTGCCGCAAAGGCCT
GGGCCGCTTCCCGGTACAGCGGCGACGAACCCGCCCTATCATCCGTCGTATCCGGCTGTCGCCCCGGCGCCACAG
AGCGGCGACGTCACGGCTCGAGTCGGCAGCCAGAACGGACCTCGGCACGGGCTTCCTCCGCCCGGGAGGTCGGCC
CCAGCTCACGGACTCCAAGCGTTGCAAGCGCGGCCTCCGGCTGCGGTAGCCCCGATGCCGGTACCGATCCCAGCC
CGTGTCTGCGTGCCCGGCATCCAAAGACCGGTGCAGGGGACGCAGCCGAAGTCGGGAACAGCGCCCCAAGCTCGG
CCTTCGTGGCAGGTGCATTCTTCCGTCTATCCTCGCTATCCCTTCTTTCAAGTCAACCACAACAGGGACGCTTCC
AAGTACCGTAGCCCGTATGCTCCGTGGGGCGGTTTCACCAACGGTTATGAGTATCTCATGCCGAGGCAAAGCGAT
CTGCTCCGGAGGCCCATGCCGAGACCCCAAGTTCCAGCCGGTCCCGGGTCCGGTTATCCGCTTCCGCAGGACGTG
GCGCGCCACAGTGGCCCTGCAAACATGGTTCCAGCGCCGGCGGCTCCTCCGGCATCGGCACCGGTGATGGCTCCC
CCGATGGGGATGGACGGCGGAATATTGCCCCCGCCGATGTTGGGAGTCTCTGGGCGGCCGCCGCACCCGGCCATC
AAGCCCGAGTACGGACTGACGTTGCCTCAGACGGGCCAGCAGCAGCAACTGCAGCAGCAACCGCCGCCGCCGCAG
TATCAGCATCCGCACCAAAATCAGCACCAGCACCAGCACCAGCATCAGCACCAGCATCAGCACCAGCCCCAGCCC
CAGCCCCAGCTCCAGCAGCCCAGGCCTGGCGTGACTCCAGCGCCCAAGTCGTACAAGGTCGGGCTGCCTACCGCC
ATCAGTCTTGCCCTGAAGTCGACAAAGCCGGCGGTGCAGACGCCGCCAAGAGAATCTCCGGTCCCGCTTCCGGCA
AATTTTTTGGCTGCCATGGCTTCTACCCCCGGCAGTCAGCAGGCGTCATCGAGCCCCAAGCCCGTCTCTCAATCT
CAGTCGCCCGGCCTTCAGGCACTAAGCACACAGGCTTCAAGCCTTCAGGCGCCCAGCATGCAGCCGCACAAGGCG
ATGATGCTGCCCCCGCCGGGCTTCTGGACCAAACAACCAATAACCATCAACCTTGATCGCCGCTACTGGCTAGCA
GCTACGCCATCGTCTGAGGGCTGGGATAACGCGGGCCAGATTCAGCAGCAGATCGGCCTAGACCCTGCCCGTTGG
ACGGAGGAAGACGAAGGCTGGTCGGCCTGGGCCCATCGTGGCATCACGCCGGCCGCTTATAAATGCGGGCCCTGC
CTCGGACAAGGTGGAAGCGCCATCGTCTACAAAGTGTGCCGAGTAGAAGATGGTAAGGTCCTCGCTGGAAAGGTG
CCGAGGGGAGAGGGCTCGGGGAGACTGGAGGCGGAGGCCAGGCTGATACGCCCGCTGAACCACCCGAACGTGCTG
AAACTTGTGGCATGGCATGAGGACTCTGCCCTGCTGGTCACCGAGTTCTGTGCTTACGATACGCTGCAAACGCGC
ATCGACAGCGGTTGGCCCAGCGCGGGTCGGATTGAGATAGCATCGGCCATGCGGCAGCTGTGCTCGGCTGTGGCC
TATCTTCACGGCCAGGGCCTTTTCCACACTGACGTCAAGCCGCGCAACGTGCTGGTGCGCGGCCTCAAGCCACTA
GACCTGGTGCTGGGCGACTGCGGCGATGCGCTGCCCATCAGTGGCAAGGTCGATCGCCTACGCGGCACACTGAGC
TTTTACTCGCCCGAGATGTGGGAGTACGCCAAGCATCACGGACCGTCGGACGATATCTGGGCTCTAGGACTGACG
CTGTTGTCCATGATGCAGCAGCTCCCCAGGCTGCGAGACAGTGGTAAAGACGATGACAAGGATGACGACGATGAC
GATGGCGGCCTGCCCAGGAAGCAGAGGCGCAAGAAGGCGCAGCAGAAGGCTGAAGACGAGATCAAGCGCTTTCCG
GGCCGGTGCTCGAAACACGCGGGCGACTTGCGGAGTCTGAACCCGGGCGATGGGCTTGTTCTGCTGGCGGAGAGA
ATGTTGGCTATGGACTGCGGACATCGTGTCTCGGCGGTGGAGGCTGAGAAGGAGGCTGAGGAGGAGGCTGCCCGA
TTGTTGGCTGAGGGGCCGTGGGATGGAGGGCCCGGGCTGCAGATTAAGGCGCCAGAGAACTTCCAGCCGGTATCT
TTTTGGTGA
Transcript >Ophcf2|03663
ATGTCCGCTGCCGAGCCCGTCGTCGGGCCTGGCCCTGGCCCTGCTTCTGGTCCTCAGCCCGGTCCCCAGGACAAG
ACGGAGTGCGCCAAACAGCCGCCGCTCGCCTTTCTTCATTCGCCGCCCGATAGCAACGAAGCGGCCAAGTCGGAT
GCCAGCGACTCGGAGCTCAGCGACCTCGAAGACGAGCCAGTTCTCGATGGACCTCCTCCTGTCCCTCTTGAGCCT
GCGATCAAGCGCGAGACCCTTGAACCACCGACAGAGACGGCGCCGCCTGCCGAAGAGCTGGGCGAGGTTCTGCCG
GACTCTTGGTCAGGCGCCGTGCCCGTGTTTCGCCCTACAGCGCGTCAGTTCAGCGACTTTCAGTGGTTTATGAAG
CAGGTCGACAGTTACGGCATGAAATCCGGCATCATCAAGATCATCCCGCCAACGGAATGGAAAGATGCTCAGCCG
CCCCTCGACGACCTCGTCAAGTACATCAAGGTTCGCGAGCCCATCAAGCAAGACATCATGGGCTCCAACGGCACC
TACCGACAAGTCAACATCCTCCACGGCCGCTCTTACAATCTGCCTCAGTGGCGACAGCTTTGCGAGCAGAGTGAG
CACCAGCCGCCAGCCAGGCGCGGTGAGCGACGCGCCAATGCCGACAAACCGAAGCCGCCGCCCCGCTCCCGTCCG
TCTCTGGGCTCCAAGACTGCCAAGCCCTCGACTCCCAAGAAGCGTGGCAAGGCGAAATCCAACAAGACTCGGGGC
AAGCAGGCCCAGAATGAGGAAGAAGATCGACCAATCACTCCCGTGTCCCCCAAGGAAGATTTTCAGGACGAACCC
GTCAACTCCATCGAGAAAGACGCTGCCGATAACGGTGATGACGCCGATAATCAAGACTGTCAACCTGCCGTAGGC
CGCATGGGCGCCATCAGGCAGCCCAAGGCCAAGACGCAGTCTGTCTCGGCCCGCCGCAAGTATAGCCGTCGCGAG
GGATCGGCCATGATCGACGAGGCAGCCTTCAAGGACTTTGACTACCGCATCGACGGCACCGAGTACACGCCCGAG
CGCTGCGAGGAGCTTGAGCGTGCCTATTGGAAGACTCTCACCTACGCGCCGCCCCTTTACGGCGCCGACATGATG
GGCACACTGTTCGATGACAGGACGCCCACCTGGAATCTCAACAAGCTGCCCAATCTTCTCGACGTGCTAGGCACC
AAGGTTCCGGGCGTCAACACGGCCTACCTATATCTAGGCATGTGGAAGGCCACTTTTGCCTGGCATCTCGAGGAC
GTGGACCTGTACAGCATCAACTACCTCCATTTCGGAGCTCCGAAGCAGTGGTACAGCATTTCCCAGGCCGACGCC
CGCCGTTTCGAGGCAGCCATGAAGAATATCTGGCCGGCCGATGCCAAGGCTTGCGACCAATTCCTCCGCCACAAG
AGCTTCCTGATCTCGCCGCATCACCTGCTGCAGCATTACGGCATCAAGGTCAACAGGGTCGTGTCGTATCCCGGC
GAGTTCGTCGTTACTTACCCCTATGGGTACCACTCCGGCTATAACTTGGGCTATAACTGTGCCGAAGCAGTCAAC
TTTGCCCTCGAGTCCTGGCTGGACATGGGCAAGATTGCAAAGAGGTGCGAATGCGCCCAGGCCCAGGACAGCGTC
TGGGTCAACGTGTACGAGATCGAGCGCAAGCTTCGTGGCGAAGAGACCGAATATGATGAGACTGAAGACGATGAC
GATGACGGCGATGGCGACGACGCAGACACGGCTGGCCTTCCGACGCCGCCGGCCGGACTCGGCGTGAGATTCAAA
GACGCTGGCCGTAAGAGGAAGCGCGCCCTCTCCGGGGTGAAGCGGCCCAAGATCAAGGTCAAGAGGATCAAGCTG
CGTCTCAAGGCCAAGGTCGAACCTCCTTGCTGCCTTTGCCCGCACGACGTGCCGGGACTTGCCATGCTTCCGACG
GACGATGGCCGGAAAGCACATCGCATGTGCGCGCTGTATGTTCCCGAGACGTACATTGACGACGTCGACGGCAAG
GAGATTGTGTGCAACGTGTCGGGTATTCACAAGGACCGCCTCGATCTCAAGTGCCTCTTCTGCCGCTCCAAGCGC
GGCGCCAGCTTTCAATGCTCCAAGAAGAAATGCGCCAGAGCGTACCACGCGACGTGCGCTGCGGCTGCGGGCGTC
TTCGTGGAGGAGCAAGACGTGCCGGTCATTGGAGAGGACGGAACCGAGTTCAAGGAGCAGGCCTTTGAGTTTAGC
TGTCGCTTCCATCGGACCAGGCGTGACAAGAAGAAGGATGGCGATGCCCTCGAGGCAGACGAGGAGGTCCGGACA
GCGGCCGCGGCCTTGGTTTGTGGAGAAATTCGCCAGTTCCAGTACGGCAAAGGCGAGATCTTTGCTGGCATGGTT
GTCGAGAACCGGCCGGAGGAGCAAACGGTTCTGCTCGACGTGATGCCGATTGGTGATCGTATCGAGGTCGAGTGG
AAGTGGCTGTTGCTTCCAGACCCGTCCGACTTCCATCTGCCCAAGGCATCAGCCAAAGCCGTGCCCCTGCCCTCG
TCGCGCAAGGCCAAGGATCAGCTGAACGCTAAGCGGTTCAACGACCGGCCGAGGAAAGACGACGTTTTTGGCGAC
GGATTCACCTGGGCCGAGTTCCAGCTCCAACCGGTCGCCAACGCGGAGCAGGCCAAGGTCGACTTCGCAAAACCA
GATCAGATATGGCACTATCTCGGCAAGAAGTCAACGGACGCGCGGGCGCAGTACACTGAGGACCCGAAGAAGTGT
CAGCACAACCCTCGAGCCAACTTCATGGACACGATCCCGAAGCCGCCGAAGCCGCCGCCGCCGCCGCCGCTGCCT
AGAAGCAACGCTCTTCAGCCCGTCAGTGCCGTTGCTCCGATGGCGTACCCGCACGCCGCCGTGGCGCGACCCGAG
AAGCCATACGTATACAAGCCTAGGAAGCCCATTAAGCCGCAGCTCGCCCCTCTCATGTACGTGCCGCAAAGGCCT
GGGCCGCTTCCCGGTACAGCGGCGACGAACCCGCCCTATCATCCGTCGTATCCGGCTGTCGCCCCGGCGCCACAG
AGCGGCGACGTCACGGCTCGAGTCGGCAGCCAGAACGGACCTCGGCACGGGCTTCCTCCGCCCGGGAGGTCGGCC
CCAGCTCACGGACTCCAAGCGTTGCAAGCGCGGCCTCCGGCTGCGGTAGCCCCGATGCCGGTACCGATCCCAGCC
CGTGTCTGCGTGCCCGGCATCCAAAGACCGGTGCAGGGGACGCAGCCGAAGTCGGGAACAGCGCCCCAAGCTCGG
CCTTCGTGGCAGGTGCATTCTTCCGTCTATCCTCGCTATCCCTTCTTTCAAGTCAACCACAACAGGGACGCTTCC
AAGTACCGTAGCCCGTATGCTCCGTGGGGCGGTTTCACCAACGGTTATGAGTATCTCATGCCGAGGCAAAGCGAT
CTGCTCCGGAGGCCCATGCCGAGACCCCAAGTTCCAGCCGGTCCCGGGTCCGGTTATCCGCTTCCGCAGGACGTG
GCGCGCCACAGTGGCCCTGCAAACATGGTTCCAGCGCCGGCGGCTCCTCCGGCATCGGCACCGGTGATGGCTCCC
CCGATGGGGATGGACGGCGGAATATTGCCCCCGCCGATGTTGGGAGTCTCTGGGCGGCCGCCGCACCCGGCCATC
AAGCCCGAGTACGGACTGACGTTGCCTCAGACGGGCCAGCAGCAGCAACTGCAGCAGCAACCGCCGCCGCCGCAG
TATCAGCATCCGCACCAAAATCAGCACCAGCACCAGCACCAGCATCAGCACCAGCATCAGCACCAGCCCCAGCCC
CAGCCCCAGCTCCAGCAGCCCAGGCCTGGCGTGACTCCAGCGCCCAAGTCGTACAAGGTCGGGCTGCCTACCGCC
ATCAGTCTTGCCCTGAAGTCGACAAAGCCGGCGGTGCAGACGCCGCCAAGAGAATCTCCGGTCCCGCTTCCGGCA
AATTTTTTGGCTGCCATGGCTTCTACCCCCGGCAGTCAGCAGGCGTCATCGAGCCCCAAGCCCGTCTCTCAATCT
CAGTCGCCCGGCCTTCAGGCACTAAGCACACAGGCTTCAAGCCTTCAGGCGCCCAGCATGCAGCCGCACAAGGCG
ATGATGCTGCCCCCGCCGGGCTTCTGGACCAAACAACCAATAACCATCAACCTTGATCGCCGCTACTGGCTAGCA
GCTACGCCATCGTCTGAGGGCTGGGATAACGCGGGCCAGATTCAGCAGCAGATCGGCCTAGACCCTGCCCGTTGG
ACGGAGGAAGACGAAGGCTGGTCGGCCTGGGCCCATCGTGGCATCACGCCGGCCGCTTATAAATGCGGGCCCTGC
CTCGGACAAGGTGGAAGCGCCATCGTCTACAAAGTGTGCCGAGTAGAAGATGGTAAGGTCCTCGCTGGAAAGGTG
CCGAGGGGAGAGGGCTCGGGGAGACTGGAGGCGGAGGCCAGGCTGATACGCCCGCTGAACCACCCGAACGTGCTG
AAACTTGTGGCATGGCATGAGGACTCTGCCCTGCTGGTCACCGAGTTCTGTGCTTACGATACGCTGCAAACGCGC
ATCGACAGCGGTTGGCCCAGCGCGGGTCGGATTGAGATAGCATCGGCCATGCGGCAGCTGTGCTCGGCTGTGGCC
TATCTTCACGGCCAGGGCCTTTTCCACACTGACGTCAAGCCGCGCAACGTGCTGGTGCGCGGCCTCAAGCCACTA
GACCTGGTGCTGGGCGACTGCGGCGATGCGCTGCCCATCAGTGGCAAGGTCGATCGCCTACGCGGCACACTGAGC
TTTTACTCGCCCGAGATGTGGGAGTACGCCAAGCATCACGGACCGTCGGACGATATCTGGGCTCTAGGACTGACG
CTGTTGTCCATGATGCAGCAGCTCCCCAGGCTGCGAGACAGTGGTAAAGACGATGACAAGGATGACGACGATGAC
GATGGCGGCCTGCCCAGGAAGCAGAGGCGCAAGAAGGCGCAGCAGAAGGCTGAAGACGAGATCAAGCGCTTTCCG
GGCCGGTGCTCGAAACACGCGGGCGACTTGCGGAGTCTGAACCCGGGCGATGGGCTTGTTCTGCTGGCGGAGAGA
ATGTTGGCTATGGACTGCGGACATCGTGTCTCGGCGGTGGAGGCTGAGAAGGAGGCTGAGGAGGAGGCTGCCCGA
TTGTTGGCTGAGGGGCCGTGGGATGGAGGGCCCGGGCTGCAGATTAAGGCGCCAGAGAACTTCCAGCCGGTATCT
TTTTGGTGA
Gene >Ophcf2|03663
ATGTCCGCTGCCGAGCCCGTCGTCGGGCCTGGCCCTGGCCCTGCTTCTGGTCCTCAGCCCGGTCCCCAGGACAAG
ACGGAGTGCGCCAAACAGCCGCCGCTCGCCTTTCTTCATTCGCCGCCCGATAGCAACGAAGCGGCCAAGTCGGAT
GCCAGCGACTCGGAGCTCAGCGACCTCGAAGACGAGCCAGTTCTCGATGGACCTCCTCCTGTCCCTCTTGAGCCT
GCGATCAAGCGCGAGACCCTTGAACCACCGACAGAGACGGCGCCGCCTGCCGAAGAGCTGGGCGAGGTTCTGCCG
GACTCTTGGTCAGGCGCCGTGCCCGTGTTTCGCCCTACAGCGCGTCAGTTCAGCGACTTTCAGTGGTTTGTATGT
CGTCGCGACCCAGTCACACCCTCAGGCTCCCGCGCTGACGTTTCTTTGTTCCTTGGTTCAGATGAAGCAGGTCGA
CAGTTACGGCATGAAATCCGGCATCATCAAGATCATCCCGCCAACGGAATGGAAAGATGCTCAGCCGCCCCTCGA
CGACCTCGTCAAGTACATCAAGGTTCGCGAGCCCATCAAGCAAGACATCATGGGCTCCAACGGCACCTACCGACA
AGTCAACATCCTCCACGGCCGCTCTTACAATCTGCCTCAGTGGCGACAGCTTTGCGAGCAGAGTGAGCACCAGCC
GCCAGCCAGGCGCGGTGAGCGACGCGCCAATGCCGACAAACCGAAGCCGCCGCCCCGCTCCCGTCCGTCTCTGGG
CTCCAAGACTGCCAAGCCCTCGACTCCCAAGAAGCGTGGCAAGGCGAAATCCAACAAGACTCGGGGCAAGCAGGC
CCAGAATGAGGAAGAAGATCGACCAATCACTCCCGTGTCCCCCAAGGAAGATTTTCAGGACGAACCCGTCAACTC
CATCGAGAAAGACGCTGCCGATAACGGTGATGACGCCGATAATCAAGACTGTCAACCTGCCGTAGGCCGCATGGG
CGCCATCAGGCAGCCCAAGGCCAAGACGCAGTCTGTCTCGGCCCGCCGCAAGTATAGCCGTCGCGAGGGATCGGC
CATGATCGACGAGGCAGCCTTCAAGGACTTTGACTACCGCATCGACGGCACCGAGTACACGCCCGAGCGCTGCGA
GGAGCTTGAGCGTGCCTATTGGAAGACTCTCACCTACGCGCCGCCCCTTTACGGCGCCGACATGATGGGCACACT
GTTCGATGACAGGACGCCCACCTGGAATCTCAACAAGCTGCCCAATCTTCTCGACGTGCTAGGCACCAAGGTTCC
GGGCGTCAACACGGCCTACCTATATCTAGGCATGTGGAAGGCCACTTTTGCCTGGCATCTCGAGGACGTGGACCT
GTACAGCATCAACTACCTCCATTTCGGAGCTCCGAAGCAGTGGTACAGCATTTCCCAGGCCGACGCCCGCCGTTT
CGAGGCAGCCATGAAGAATATCTGGCCGGCCGATGCCAAGGCTTGCGACCAATTCCTCCGCCACAAGAGCTTCCT
GATCTCGCCGCATCACCTGCTGCAGCATTACGGCATCAAGGTCAACAGGGTCGTGTCGTATCCCGGCGAGTTCGT
CGTTACTTACCCCTATGGGTACCACTCCGGCTATAACTTGGGCTATAACTGTGCCGAAGCAGTCAACTTTGCCCT
CGAGTCCTGGCTGGACATGGGCAAGATTGCAAAGAGGTGCGAATGCGCCCAGGCCCAGGACAGCGTCTGGGTCAA
CGTGTACGAGATCGAGCGCAAGCTTCGTGGCGAAGAGACCGAATATGATGAGACTGAAGACGATGACGATGACGG
CGATGGCGACGACGCAGACACGGCTGGCCTTCCGACGCCGCCGGCCGGACTCGGCGTGAGATTCAAAGACGCTGG
CCGTAAGAGGAAGCGCGCCCTCTCCGGGGTGAAGCGGCCCAAGATCAAGGTCAAGAGGATCAAGCTGCGTCTCAA
GGCCAAGGTCGAACCTCCTTGCTGCCTTTGCCCGCACGACGTGCCGGGACTTGCCATGCTTCCGACGGACGATGG
CCGGAAAGCACATCGCATGTGCGCGCTGTATGTTCCCGAGACGTACATTGACGACGTCGACGGCAAGGAGATTGT
GTGCAACGTGTCGGGTATTCACAAGGACCGCCTCGATCTCAAGTGCCTCTTCTGCCGCTCCAAGCGCGGCGCCAG
CTTTCAATGCTCCAAGAAGAAATGCGCCAGAGCGTACCACGCGACGTGCGCTGCGGCTGCGGGCGTCTTCGTGGA
GGAGCAAGACGTGCCGGTCATTGGAGAGGACGGAACCGAGTTCAAGGAGCAGGCCTTTGAGTTTAGCTGTCGCTT
CCATCGGACCAGGCGTGACAAGAAGAAGGATGGCGATGCCCTCGAGGCAGACGAGGAGGTCCGGACAGCGGCCGC
GGCCTTGGTTTGTGGAGAAATTCGCCAGTTCCAGTACGGCAAAGGCGAGATCTTTGCTGGCATGGTTGTCGAGAA
CCGGCCGGAGGAGCAAACGGTTCTGCTCGACGTGATGCCGATTGGGTATGAATTCCGCACGCCGAAAGGGCGAGG
AACCTCAGCTGACGAGCAACGCAGTGATCGTATCGAGGTCGAGTGGAAGTGGCTGTTGCTTCCAGACCCGTCCGA
CTTCCATCTGCCCAAGGCATCAGCCAAAGCCGTGCCCCTGCCCTCGTCGCGCAAGGCCAAGGATCAGCTGAACGC
TAAGCGGTTCAACGACCGGCCGAGGAAAGACGACGTTTTTGGCGACGGATTCACCTGGGCCGAGTTCCAGCTCCA
ACCGGTCGCCAACGCGGAGCAGGCCAAGGTCGACTTCGCAAAACCAGATCAGATATGGCACTATCTCGGCAAGAA
GTCAACGGACGCGCGGGCGCAGTACACTGAGGACCCGAAGAAGTGTCAGCACAACCCTCGAGCCAACTTCATGGA
CACGATCCCGAAGCCGCCGAAGCCGCCGCCGCCGCCGCCGCTGCCTAGAAGCAACGCTCTTCAGCCCGTCAGTGC
CGTTGCTCCGATGGCGTACCCGCACGCCGCCGTGGCGCGACCCGAGAAGCCATACGTATACAAGCCTAGGAAGCC
CATTAAGCCGCAGCTCGCCCCTCTCATGTACGTGCCGCAAAGGCCTGGGCCGCTTCCCGGTACAGCGGCGACGAA
CCCGCCCTATCATCCGTCGTATCCGGCTGTCGCCCCGGCGCCACAGAGCGGCGACGTCACGGCTCGAGTCGGCAG
CCAGAACGGACCTCGGCACGGGCTTCCTCCGCCCGGGAGGTCGGCCCCAGCTCACGGACTCCAAGCGTTGCAAGC
GCGGCCTCCGGCTGCGGTAGCCCCGATGCCGGTACCGATCCCAGCCCGTGTCTGCGTGCCCGGCATCCAAAGACC
GGTGCAGGGGACGCAGCCGAAGTCGGGAACAGCGCCCCAAGCTCGGCCTTCGTGGCAGGTGCATTCTTCCGTCTA
TCCTCGCTATCCCTTCTTTCAAGTCAACCACAACAGGTCAGTCAATCTCGTCGTTGGTATTTCTGGGCCTCACCT
GACCGGCATCATGTAACACAGGGACGCTTCCAAGTACCGTAGCCCGTATGCTCCGTGGGGCGGTTTCACCAACGG
TTATGAGTATCTCATGCCGAGGCAAAGCGATCTGCTCCGGAGGCCCATGCCGAGACCCCAAGTTCCAGCCGGTCC
CGGGTCCGGTTATCCGCTTCCGCAGGACGTGGCGCGCCACAGTGGCCCTGCAAACATGGTTCCAGCGCCGGCGGC
TCCTCCGGCATCGGCACCGGTGATGGCTCCCCCGATGGGGATGGACGGCGGAATATTGCCCCCGCCGATGTTGGG
AGTCTCTGGGCGGCCGCCGCACCCGGCCATCAAGCCCGAGTACGGACTGACGTTGCCTCAGACGGGCCAGCAGCA
GCAACTGCAGCAGCAACCGCCGCCGCCGCAGTATCAGCATCCGCACCAAAATCAGCACCAGCACCAGCACCAGCA
TCAGCACCAGCATCAGCACCAGCCCCAGCCCCAGCCCCAGCTCCAGCAGCCCAGGCCTGGCGTGACTCCAGCGCC
CAAGTCGTACAAGGTCGGGCTGCCTACCGCCATCAGTCTTGCCCTGAAGTCGACAAAGCCGGCGGTGCAGACGCC
GCCAAGAGAATCTCCGGTCCCGCTTCCGGCAAATTTTTTGGCTGCCATGGCTTCTACCCCCGGCAGTCAGCAGGC
GTCATCGAGCCCCAAGCCCGTCTCTCAATCTCAGTCGCCCGGCCTTCAGGCACTAAGCACACAGGCTTCAAGCCT
TCAGGCGCCCAGCATGCAGCCGCACAAGGCGATGATGCTGCCCCCGCCGGGCTTCTGTCAGCAGCCAGTGGCGTC
ACTTGAGAGTCAAATCGACAGTGGTGTGCAGCTCCCGCACTCGGGTTCCATTGCTGGTTCCAGAATAGAGACTGA
CGGCAATCAGCCGTCGAAAACATCGGAAATGCCCCCTAACCCACCGGTTTCCTCGGCACAGACAGGGCCGGGAGC
CGAAGCGTCCACGTCGGGCGAGTGCACTGTTGAGAACGGAACCCCCCGTGCAGGGATTTCGGGGCCGCGAGTCGA
GCTGCAGCAGGAGTTTCCCGACGTACCAGGCAGCGAGTCAATGAGGTTCGTCGAGAGGATGATGGAAAACCTCAA
GAGGGTCTCGCAGCGAGCAGACGTCGACAACGGGAATTGAGGCAGACATGGAGCGGCTCGACGAGTACATATCAT
GGTCGGGCAGCGGGAGAAAAGAAGTCCAGGTCGGGCAGCAGGGCGTTGGACGTGCATTTCTGGCAGGGCAAAATC
CAGGGGGCGTTTCTGTGCTTGTACGATGGGAGATGAAAGACGGTGGTGGCTTGCTTGGGGTGGAGTGAAGATGAG
TGAGAGAGGGAGAAGTGGGGAGGGGGAGCAGTGAAAGATGAGGTATTCGTACTTGGTGCTACCTGTTGGTAGGCG
TCAGCGAAATTTACTGGGGCAAAATGCATGCCTCTTTTATTTATACATACATAGGACGATATTCACAGGCTGGAC
GAGGTAGTGTATAAAGAAGAGACGAATTGCCCGTTGTTCCAATGGTAGTGGAGAGGAGTATTAGACGAGAAGGAC
CCTGCACACTAACACCAGGTACCGGTTGCCATTGCCGTCAACAAGTCGCTGGTTACCGCCATCGAATCCTTTAAC
AAACCTGCAACCACAAGAGAGAGTCCGTCTTTTACAGAGACATACAAACCATACACACACCTACATACACACATA
CATAGGCAGACGACGGGATTTTCACTGCTTGTGCTGACAGGGACCAAACAACCAATAACCATCAACCTTGATCGC
CGCTACTGGCTAGGTACTAGGTATGGATCCATCTGTGAACCGCAGACGTCGTCGAGGCAGACGCGGACTTCGAGG
AGGGTGCGAGACACGAGACGGAAACGCAGCAGCTACGCCATCGTCTGAGGGCTGGGATAACGCGGGCCAGATTCA
GCAGCAGATCGGCCTAGACCCTGCCCGTTGGACGGAGGAAGACGAAGGCTGGTCGGCCTGGGCCCATCGTGGCAT
CACGCCGGCCGCTTATAAATGCGGGCCCTGCCTCGGACAAGGTGGAAGCGCCATCGTCTACAAAGTGTGCCGAGT
AGAAGATGGTAAGGTCCTCGCTGGAAAGGTGCCGAGGGGAGAGGGCTCGGGGAGACTGGAGGCGGAGGCCAGGCT
GATACGCCCGCTGAACCACGTAAGTCATCACGTCCGAGAGGGGGATCCTGTCTGATTTTTCCTCCCAGCCGAACG
TGCTGAAACTTGTGGCATGGCATGAGGACTCTGCCCTGCTGGTCACCGAGTTCTGTGCTTACGATACGCTGCAAA
CGCGCATCGACAGCGGTTGGCCCAGCGCGGGTCGGATTGAGATAGCATCGGCCATGCGGCAGCTGTGCTCGGCTG
TGGCCTATCTTCACGGCCAGGGCCTTTTCCACACTGACGTCAAGCCGCGCAACGTGCTGGTGCGCGGCCTCAAGC
CACTAGACCTGGTGCTGGGCGACTGCGGCGATGCGCTGCCCATCAGTGGCAAGGTCGATCGCCTACGCGGCACAC
TGAGCTTTTACTCGCCCGAGATGTGGGAGTACGCCAAGCATCACGGACCGTCGGACGATATCTGGGCTCTAGGAC
TGACGCTGTTGTCCATGATGCAGCAGCTCCCCAGGCTGCGAGACAGTGGTAAAGACGATGACAAGGATGACGACG
ATGACGATGGCGGCCTGCCCAGGAAGCAGAGGCGCAAGAAGGCGCAGCAGAAGGCTGAAGACGAGATCAAGCGCT
TTCCGGGCCGGTGCTCGAAACACGCGGGCGACTTGCGGAGTCTGAACCCGGGCGATGGGCTTGTTCTGCTGGCGG
AGAGAATGTTGGCTATGGACTGCGGACATCGTGTCTCGGCGGTGGAGGCTGAGAAGGAGGCTGAGGAGGAGGCTG
CCCGATTGTTGGCTGAGGGGCCGTGGGATGGAGGGCCCGGGCTGCAGATTAAGGCGCCAGAGAACTTCCAGCCGG
TATCTTTTTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail