Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03656
Gene name
Locationscaffold_03:3436930..3439891
Strand-
Gene length (bp)2961
Transcript length (bp)2634
Coding sequence length (bp)2634
Protein length (aa) 878

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 5.7E-80 309 686

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005247 voltage-gated chloride channel activity Yes
GO:0006821 chloride transport Yes
GO:0055085 transmembrane transport Yes
GO:0015267 channel activity No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005244 voltage-gated ion channel activity No
GO:0006810 transport No
GO:0022836 gated channel activity No
GO:0009987 cellular process No
GO:0022832 voltage-gated channel activity No
GO:0110165 cellular anatomical entity No
GO:0008308 voltage-gated anion channel activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006820 anion transport No
GO:0022803 passive transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015108 chloride transmembrane transporter activity No
GO:0005254 chloride channel activity No
GO:0006811 ion transport No
GO:0008150 biological_process No
GO:0005253 anion channel activity No
GO:0051179 localization No
GO:0005216 ion channel activity No
GO:0008509 anion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 154 176 22
2 232 254 22
3 325 347 22
4 389 411 22
5 423 445 22
6 460 482 22
7 503 522 19
8 561 583 22
9 590 612 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 76.67 41.92 111.42
Alive In ants, during behavior modification 32.15 17.68 46.61
Dead In ants, recently dead 24.42 13.65 35.19

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.092013 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03656
MAIGDPEPPDPSSQASSPLTMRRPSSLRRWHSSGEPDERSPLLVPPPRTTSRPRVRIRSGANSPRFPSLSRNQSN
AGSVFGARHFSRHESLSQRLLSAFADGRGSIAGSKSSLFVDERVWYDQFTSTDWVHDAIADSHRVKALRNRRGFW
GRAAILFDGVQGWILSALSGFVVALIAYAVDVSEATVFDYKDGYCARAWYLGEQKCCPRGPCEDWKNWSEVVSTS
PLGPRWTEFTIYISCVIGFAVFSCWLALWTETVVPSAYRLTTLDENLAALSPPHLSDEGQTDDSASPRRRSDADG
ANPPMVYYSAAGSGVAEVRVIISGFVLHGFLGFKTLVIKMVSLIFSVSSGLSLGKEGPFVHMATCVGNIACRLFP
KYDQNDAKRREALSAAAAAGVAVAFGAPLGGVLFGLEEVAYFFPAKTLFRTFFCCIIAALSLKFLNPFGTHKIVM
FEVRYLVDWDFFELLGFIFVGVLGGAIGALFIKAHKHWAHSFRRIRVIKAYPMFEVFLVAAITGLMSYWNVLTKL
PVAKLLFNLASPCDHSSDGYEDELGLCVKSAEDIPGVIRNLLIAFVIKGFLTVITFGIKVPSGIYIPSMVVGGLL
GRIVGHLMQWLVMSVPHWRIFGNCATATEGTCVQPGVYGLIAAGATMCGTTRLSVTLAVILFELTGSLDYVLPFS
LSILVSKWTADAIEPHSIYDLLTSMNSYPFLDNKRKPVFTGDLEDIVPRLRRERVIDITDSPLVSAASLRAKLEV
LHRSAELDGGLPIVRYGVLVGLIPAPDLEYALDQLEDEDSSMCLMDRVPSIDDDDVCEADPTDFARYIDPAPVAL
DIRSPMDLVYECFVKLGLRYICVLKDGKYAGMTHKKTFVKYMRQLEEDGDWS*
Coding >Ophcf2|03656
ATGGCCATTGGTGACCCTGAGCCGCCGGACCCTTCTTCTCAAGCGTCGTCCCCTCTGACGATGCGCCGGCCTTCT
TCCTTACGCCGATGGCACTCGAGCGGAGAGCCTGACGAGCGGTCGCCGCTACTGGTGCCGCCTCCGAGGACGACG
TCGAGGCCCCGAGTTCGAATCCGCAGCGGCGCCAACTCTCCCCGCTTTCCGTCTCTCTCTCGGAACCAGAGCAAC
GCAGGAAGCGTCTTTGGCGCGCGACATTTCAGTCGACACGAGTCACTGAGTCAGAGACTGCTATCAGCCTTCGCC
GACGGGCGTGGATCCATTGCGGGCTCCAAGAGCTCCCTGTTCGTCGACGAACGAGTTTGGTACGATCAGTTCACA
AGCACCGACTGGGTGCATGATGCCATTGCCGATTCACACCGAGTCAAGGCCCTCCGCAACAGAAGGGGCTTCTGG
GGCCGTGCCGCCATATTGTTTGACGGTGTTCAGGGCTGGATTCTCAGCGCGCTTTCGGGCTTCGTTGTGGCTCTC
ATTGCCTACGCCGTCGACGTGAGTGAGGCTACCGTCTTCGATTACAAGGATGGCTACTGTGCCAGGGCGTGGTAT
CTCGGGGAGCAGAAATGCTGCCCTCGTGGGCCTTGCGAGGACTGGAAGAACTGGTCCGAAGTCGTCAGCACCAGC
CCTCTCGGTCCGAGGTGGACCGAATTCACCATATACATATCGTGCGTCATCGGCTTCGCCGTCTTTTCCTGCTGG
CTAGCTCTGTGGACGGAGACGGTAGTTCCATCTGCATACCGCCTGACGACGCTCGACGAGAACTTGGCCGCGCTG
AGCCCACCCCATCTTTCAGACGAGGGCCAGACGGACGATTCGGCGAGTCCCCGGCGCCGGAGCGACGCCGACGGC
GCGAATCCGCCGATGGTTTATTACTCGGCAGCCGGCAGCGGTGTGGCCGAGGTGCGTGTCATCATCAGCGGTTTC
GTTCTGCACGGCTTCCTCGGCTTCAAGACGCTGGTCATCAAGATGGTCTCGCTCATCTTCAGCGTCTCGTCCGGC
CTCAGCCTGGGAAAGGAAGGGCCGTTTGTTCACATGGCGACGTGCGTCGGCAACATCGCCTGTCGACTGTTCCCC
AAGTATGACCAGAACGATGCCAAGCGGCGAGAGGCCCTCTCTGCAGCGGCGGCGGCCGGCGTTGCTGTCGCCTTT
GGAGCGCCGTTGGGAGGCGTCTTGTTCGGGCTCGAGGAGGTGGCCTACTTCTTCCCGGCCAAGACGCTGTTCCGG
ACCTTTTTCTGCTGCATCATTGCCGCCCTGTCGCTCAAGTTCCTCAACCCTTTCGGCACCCACAAGATTGTCATG
TTCGAGGTGCGCTACCTCGTCGACTGGGACTTTTTCGAGCTGCTGGGCTTCATCTTCGTCGGCGTCCTCGGCGGT
GCCATTGGTGCGCTCTTCATCAAGGCTCACAAGCACTGGGCCCATAGCTTCCGCCGGATCCGCGTCATCAAGGCC
TACCCCATGTTTGAAGTCTTTCTCGTTGCCGCCATCACCGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTG
CCTGTGGCCAAGCTGCTCTTCAACCTGGCGTCCCCATGCGATCACTCATCTGACGGCTACGAGGATGAGCTCGGC
CTGTGTGTGAAGTCTGCCGAGGACATTCCGGGCGTCATCCGGAACCTCTTGATTGCTTTCGTCATCAAGGGGTTT
CTAACCGTCATCACCTTTGGCATTAAAGTTCCGTCCGGCATTTATATTCCATCCATGGTAGTGGGCGGTCTGCTG
GGCCGCATCGTAGGCCACCTAATGCAATGGCTGGTGATGTCGGTACCGCACTGGCGCATCTTTGGCAACTGTGCC
ACGGCCACGGAAGGGACCTGTGTCCAACCCGGCGTGTACGGCCTCATTGCAGCCGGGGCGACCATGTGCGGGACG
ACGAGGCTGTCGGTGACGCTGGCTGTCATTCTCTTTGAGCTGACAGGCAGTCTGGACTACGTCCTCCCGTTTTCT
CTGTCCATTTTGGTTTCCAAGTGGACGGCGGATGCCATTGAGCCGCACAGCATCTACGACCTTCTCACGAGCATG
AACTCGTACCCGTTCCTGGACAACAAACGCAAGCCTGTCTTCACCGGCGACTTGGAAGACATCGTGCCGCGGCTG
CGACGAGAGCGGGTGATTGACATAACCGACTCGCCTCTGGTGTCAGCAGCGAGTCTCCGGGCCAAGCTCGAGGTG
CTGCACCGTTCAGCCGAGCTGGACGGCGGGCTGCCGATTGTGCGGTACGGGGTGCTGGTCGGGCTGATCCCGGCG
CCGGACCTCGAGTACGCGCTCGATCAGCTGGAGGACGAGGACTCGAGCATGTGTCTCATGGACAGGGTACCGAGT
ATCGACGACGACGACGTATGCGAGGCGGACCCGACGGACTTCGCGCGCTACATCGATCCGGCTCCCGTTGCGCTA
GACATACGGTCGCCGATGGACCTCGTGTACGAGTGCTTCGTCAAGCTGGGTCTCCGGTACATTTGCGTGCTCAAA
GATGGCAAATACGCGGGCATGACACACAAGAAGACGTTTGTCAAGTACATGAGGCAGCTCGAAGAGGACGGAGAT
TGGAGTTGA
Transcript >Ophcf2|03656
ATGGCCATTGGTGACCCTGAGCCGCCGGACCCTTCTTCTCAAGCGTCGTCCCCTCTGACGATGCGCCGGCCTTCT
TCCTTACGCCGATGGCACTCGAGCGGAGAGCCTGACGAGCGGTCGCCGCTACTGGTGCCGCCTCCGAGGACGACG
TCGAGGCCCCGAGTTCGAATCCGCAGCGGCGCCAACTCTCCCCGCTTTCCGTCTCTCTCTCGGAACCAGAGCAAC
GCAGGAAGCGTCTTTGGCGCGCGACATTTCAGTCGACACGAGTCACTGAGTCAGAGACTGCTATCAGCCTTCGCC
GACGGGCGTGGATCCATTGCGGGCTCCAAGAGCTCCCTGTTCGTCGACGAACGAGTTTGGTACGATCAGTTCACA
AGCACCGACTGGGTGCATGATGCCATTGCCGATTCACACCGAGTCAAGGCCCTCCGCAACAGAAGGGGCTTCTGG
GGCCGTGCCGCCATATTGTTTGACGGTGTTCAGGGCTGGATTCTCAGCGCGCTTTCGGGCTTCGTTGTGGCTCTC
ATTGCCTACGCCGTCGACGTGAGTGAGGCTACCGTCTTCGATTACAAGGATGGCTACTGTGCCAGGGCGTGGTAT
CTCGGGGAGCAGAAATGCTGCCCTCGTGGGCCTTGCGAGGACTGGAAGAACTGGTCCGAAGTCGTCAGCACCAGC
CCTCTCGGTCCGAGGTGGACCGAATTCACCATATACATATCGTGCGTCATCGGCTTCGCCGTCTTTTCCTGCTGG
CTAGCTCTGTGGACGGAGACGGTAGTTCCATCTGCATACCGCCTGACGACGCTCGACGAGAACTTGGCCGCGCTG
AGCCCACCCCATCTTTCAGACGAGGGCCAGACGGACGATTCGGCGAGTCCCCGGCGCCGGAGCGACGCCGACGGC
GCGAATCCGCCGATGGTTTATTACTCGGCAGCCGGCAGCGGTGTGGCCGAGGTGCGTGTCATCATCAGCGGTTTC
GTTCTGCACGGCTTCCTCGGCTTCAAGACGCTGGTCATCAAGATGGTCTCGCTCATCTTCAGCGTCTCGTCCGGC
CTCAGCCTGGGAAAGGAAGGGCCGTTTGTTCACATGGCGACGTGCGTCGGCAACATCGCCTGTCGACTGTTCCCC
AAGTATGACCAGAACGATGCCAAGCGGCGAGAGGCCCTCTCTGCAGCGGCGGCGGCCGGCGTTGCTGTCGCCTTT
GGAGCGCCGTTGGGAGGCGTCTTGTTCGGGCTCGAGGAGGTGGCCTACTTCTTCCCGGCCAAGACGCTGTTCCGG
ACCTTTTTCTGCTGCATCATTGCCGCCCTGTCGCTCAAGTTCCTCAACCCTTTCGGCACCCACAAGATTGTCATG
TTCGAGGTGCGCTACCTCGTCGACTGGGACTTTTTCGAGCTGCTGGGCTTCATCTTCGTCGGCGTCCTCGGCGGT
GCCATTGGTGCGCTCTTCATCAAGGCTCACAAGCACTGGGCCCATAGCTTCCGCCGGATCCGCGTCATCAAGGCC
TACCCCATGTTTGAAGTCTTTCTCGTTGCCGCCATCACCGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTG
CCTGTGGCCAAGCTGCTCTTCAACCTGGCGTCCCCATGCGATCACTCATCTGACGGCTACGAGGATGAGCTCGGC
CTGTGTGTGAAGTCTGCCGAGGACATTCCGGGCGTCATCCGGAACCTCTTGATTGCTTTCGTCATCAAGGGGTTT
CTAACCGTCATCACCTTTGGCATTAAAGTTCCGTCCGGCATTTATATTCCATCCATGGTAGTGGGCGGTCTGCTG
GGCCGCATCGTAGGCCACCTAATGCAATGGCTGGTGATGTCGGTACCGCACTGGCGCATCTTTGGCAACTGTGCC
ACGGCCACGGAAGGGACCTGTGTCCAACCCGGCGTGTACGGCCTCATTGCAGCCGGGGCGACCATGTGCGGGACG
ACGAGGCTGTCGGTGACGCTGGCTGTCATTCTCTTTGAGCTGACAGGCAGTCTGGACTACGTCCTCCCGTTTTCT
CTGTCCATTTTGGTTTCCAAGTGGACGGCGGATGCCATTGAGCCGCACAGCATCTACGACCTTCTCACGAGCATG
AACTCGTACCCGTTCCTGGACAACAAACGCAAGCCTGTCTTCACCGGCGACTTGGAAGACATCGTGCCGCGGCTG
CGACGAGAGCGGGTGATTGACATAACCGACTCGCCTCTGGTGTCAGCAGCGAGTCTCCGGGCCAAGCTCGAGGTG
CTGCACCGTTCAGCCGAGCTGGACGGCGGGCTGCCGATTGTGCGGTACGGGGTGCTGGTCGGGCTGATCCCGGCG
CCGGACCTCGAGTACGCGCTCGATCAGCTGGAGGACGAGGACTCGAGCATGTGTCTCATGGACAGGGTACCGAGT
ATCGACGACGACGACGTATGCGAGGCGGACCCGACGGACTTCGCGCGCTACATCGATCCGGCTCCCGTTGCGCTA
GACATACGGTCGCCGATGGACCTCGTGTACGAGTGCTTCGTCAAGCTGGGTCTCCGGTACATTTGCGTGCTCAAA
GATGGCAAATACGCGGGCATGACACACAAGAAGACGTTTGTCAAGTACATGAGGCAGCTCGAAGAGGACGGAGAT
TGGAGTTGA
Gene >Ophcf2|03656
ATGGCCATTGGTGACCCTGAGCCGCCGGACCCTTCTTCTCAAGCGTCGTCCCCTCTGACGATGCGCCGGCCTTCT
TCCTTACGCCGATGGCACTCGAGCGGAGAGCCTGACGAGCGGTCGCCGCTACTGGTGCCGCCTCCGAGGACGACG
TCGAGGCCCCGAGTTCGAATCCGCAGCGGCGCCAACTCTCCCCGCTTTCCGTCTCTCTCTCGGAACCAGAGCAAC
GCAGGTGAGGAGGCTTCCCGTTCGAAGTTGGCTTACACTTCACCATCTGCTGACGTCCGTCCACCTGGCTTATAG
GAAGCGTCTTTGGCGCGCGACATTTCAGTCGACACGAGTCACTGAGTCAGAGACTGCTATCAGCCTTCGCCGACG
GGCGTGGATCCATTGCGGGCTCCAAGAGCTCCCTGTTCGTCGACGAACGAGTTTGGTACGATCAGTTCACAAGCA
CCGACTGGGTGCATGATGCCATTGCCGATTCACACCGAGTCAAGGCCCTCCGCAACAGAAGGGGCTTCTGGGGCC
GTGCCGCCATATTGTTTGACGGTGTTCAGGGCTGGATTCTCAGCGCGCTTTCGGGCTTCGTTGTGGCTCTCATTG
CCTACGCCGTCGACGTGAGTGAGGCTACCGTCTTCGATTACAAGGATGGCTACTGTGCCAGGGCGTGGTATCTCG
GGGAGCAGGTGAGGCCTTGGTCTGCGAGCCGCTGGCTTGCGTGTGCTTACGCGCTTGACAGAAATGCTGCCCTCG
TGGGCCTTGCGAGGACTGGAAGAACTGGTCCGAAGTCGTCAGCACCAGCCCTCTCGGTCCGAGGTGGACCGAATT
CACCATATACATATCGTGCGTCATCGGCTTCGCCGTCTTTTCCTGCTGGCTAGCTCTGTGGACGGAGACGGTAGT
TCCATCTGCATACCGCCTGACGACGCTCGACGAGAACTTGGCCGCGCTGAGCCCACCCCATCTTTCAGACGAGGG
CCAGACGGACGATTCGGCGAGTCCCCGGCGCCGGAGCGACGCCGACGGCGCGAATCCGCCGATGGTTTATTACTC
GGCAGCCGGCAGCGGTGTGGCCGAGGTGCGTGTCATCATCAGCGGTTTCGTTCTGCACGGCTTCCTCGGCTTCAA
GACGCTGGTCATCAAGATGGTCTCGCTCATCTTCAGCGTCTCGTCCGGCCTCAGCCTGGGAAAGGAAGGGCCGTT
TGTTCACATGGCGACGTGCGTCGGCAACATCGCCTGTCGACTGTTCCCCAAGTATGACCAGAACGATGCCAAGCG
GCGAGAGGCCCTCTCTGCAGCGGCGGCGGCCGGCGTTGCTGTCGCCTTTGGAGCGCCGTTGGGAGGCGTCTTGTT
CGGGCTCGAGGAGGTGGCCTACTTCTTCCCGGCCAAGACGCTGTTCCGGACCTTTTTCTGCTGCATCATTGCCGC
CCTGTCGCTCAAGTTCCTCAACCCTTTCGGCACCCACAAGATTGTCATGTTCGAGGTGCGCTACCTCGTCGACTG
GGACTTTTTCGAGCTGCTGGGCTTCATCTTCGTCGGCGTCCTCGGCGGTGCCATTGGTGCGCTCTTCATCAAGGC
TCACAAGCACTGGGCCCATAGCTTCCGCCGGATCCGCGTCATCAAGGCCTACCCCATGTTTGAAGTCTTTCTCGT
TGCCGCCATCACCGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTGCCTGTGGCCAAGCTGCTCTTCAACCT
GGCGTCCCCATGCGATCACTCATCTGACGGCTACGAGGATGAGCTCGGCCTGTGTGTGAAGTCTGCCGAGGACAT
TCCGGGCGTCATCCGGAACCTCTTGATTGCTTTCGTCATCAAGGGGTTTCTAACCGTCATCACCTTTGGCATTGT
GAGTGGCCGGCGGGACGGTACGATGGTAGTTGAGCTAATGGAATGGATAGAAAGTTCCGTCCGGCATTTATATTC
CATCCATGGTAGTGGGCGGTCTGCTGGGCCGCATCGTAGGCCACCTAATGCAATGGCTGGTGATGTCGGTACCGC
ACTGGCGCATCTTTGGCAACTGTGCCACGGCCACGGAAGGGACCTGTGTCCAACCCGGCGTGTACGGCCTCATTG
CAGCCGGGGCGACCATGTGCGGGACGACGAGGCTGTCGGTGACGCTGGCTGTCATTCTCTTTGAGCTGACAGGCA
GTCTGGACTACGTCCTCCCGTTTTCTCTGTCCATTTTGGTTTCCAAGTGGACGGCGGATGCCATTGAGCCGCACA
GCATCTACGTGAGCGTGAAATTCCTGGGCGGAGGTTAGCGACTGACTGCTACGGACAGGACCTTCTCACGAGCAT
GAACTCGTACCCGTTCCTGGACAACAAACGCAAGCCTGTCTTCACCGGCGACTTGGAAGACATCGTGCCGCGGCT
GCGACGAGAGCGGGTGATTGACATAACCGACTCGCCTCTGGTGTCAGCAGCGAGTCTCCGGGCCAAGCTCGAGGT
GCTGCACCGTTCAGCCGAGCTGGACGGCGGGCTGCCGATTGTGCGGTACGGGGTGCTGGTCGGGCTGATCCCGGC
GCCGGACCTCGAGTACGCGCTCGATCAGCTGGAGGACGAGGACTCGAGCATGTGTCTCATGGACAGGGTACCGAG
TATCGACGACGACGACGTATGCGAGGCGGACCCGACGGACTTCGCGCGCTACATCGATCCGGTGAGTCGGCCCGG
GCATGGTGGCGGAACACGGCTGACGGGGTTGTGGCAGGCTCCCGTTGCGCTAGACATACGGTCGCCGATGGACCT
CGTGTACGAGTGCTTCGTCAAGCTGGGTCTCCGGTACATTTGCGTGCTCAAAGATGGCAAATACGCGGGCATGGT
AAGCGGTACAGAGTCGACCAGTCGGGACGATGGGCTAAGACGACGCAGACACACAAGAAGACGTTTGTCAAGTAC
ATGAGGCAGCTCGAAGAGGACGGAGATTGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail