Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03643
Gene name
Locationscaffold_03:3400424..3401654
Strand-
Gene length (bp)1230
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 3.3E-12 199 247

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005515 protein binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4507 0.9351 0.0769 0.0138 0.1219 0.0002 0.0475 0.0383 0.0315 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3443
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7106
Ophiocordyceps australis map64 (Brazil) OphauB2|584
Ophiocordyceps camponoti-floridani Ophcf2|03643 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1308
Ophiocordyceps kimflemingae Ophio5|7856
Ophiocordyceps subramaniannii Hirsu2|6546

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03643
MISEPCQLAPEMSALTGSPGQKRKREAVSPGLQRAKRTAPPAAMSADTAAFIENAIEATQAAAASGVSGVSGVSG
VSVADFSALQQAAAAEHSESADPSNATTTAQAALGMYPTLHVPASTEEQFAAQAVAEGDHGPDNSYNPDVTQSES
MMDAQPVSPSQQHQGPPPPPANGIQSGPRYSTSSNAKPSVGSEEWHKMRKDNHKEVERRRRETINEGINELAKIV
PGCEKNKGSILQRAVSFISQLKENEQQNIEKWTLEKLLTEQAITELSASNDKLKQECERLYRELETWKRVAQNAG
LEPPQPKDEPGSTAPPS*
Coding >Ophcf2|03643
ATGATCAGCGAGCCTTGCCAGCTCGCTCCAGAGATGTCGGCCCTGACCGGCTCTCCAGGACAGAAGCGAAAGCGA
GAGGCCGTCAGCCCCGGACTCCAGCGCGCCAAGCGGACGGCACCTCCCGCCGCCATGTCTGCCGACACCGCCGCC
TTCATCGAGAACGCCATAGAGGCCACCCAAGCCGCAGCCGCCAGCGGTGTCAGCGGTGTCAGCGGTGTCAGCGGT
GTCAGCGTCGCCGACTTCAGCGCCCTTCAGCAGGCCGCCGCTGCCGAACACTCCGAGTCGGCAGACCCGTCCAAC
GCCACAACCACCGCCCAGGCCGCCCTGGGCATGTACCCGACGCTCCACGTCCCGGCCTCGACGGAGGAGCAGTTC
GCCGCCCAGGCCGTCGCCGAGGGCGATCACGGGCCCGACAACTCCTATAACCCCGACGTCACCCAGTCCGAGTCC
ATGATGGACGCCCAGCCCGTGAGTCCTAGCCAGCAGCATCAGGGTCCCCCCCCTCCCCCCGCCAACGGTATCCAG
TCCGGTCCCAGATACTCTACCTCTTCCAATGCCAAGCCCAGCGTCGGTTCCGAGGAGTGGCACAAGATGCGCAAG
GATAACCACAAGGAAGTGGAACGACGTCGCAGAGAGACCATCAACGAGGGCATCAACGAGTTGGCAAAGATCGTG
CCGGGCTGCGAAAAGAACAAGGGTTCCATTCTCCAACGAGCCGTCAGCTTCATATCGCAACTCAAGGAAAACGAG
CAGCAAAACATTGAAAAGTGGACGTTGGAAAAACTCCTCACCGAACAGGCCATCACCGAACTCAGCGCCTCAAAC
GACAAGCTCAAGCAGGAATGCGAGCGTCTCTACCGCGAACTCGAGACGTGGAAGCGCGTAGCCCAAAACGCTGGC
CTCGAACCGCCACAGCCAAAGGACGAGCCGGGCTCAACCGCGCCTCCCAGTTAG
Transcript >Ophcf2|03643
ATGATCAGCGAGCCTTGCCAGCTCGCTCCAGAGATGTCGGCCCTGACCGGCTCTCCAGGACAGAAGCGAAAGCGA
GAGGCCGTCAGCCCCGGACTCCAGCGCGCCAAGCGGACGGCACCTCCCGCCGCCATGTCTGCCGACACCGCCGCC
TTCATCGAGAACGCCATAGAGGCCACCCAAGCCGCAGCCGCCAGCGGTGTCAGCGGTGTCAGCGGTGTCAGCGGT
GTCAGCGTCGCCGACTTCAGCGCCCTTCAGCAGGCCGCCGCTGCCGAACACTCCGAGTCGGCAGACCCGTCCAAC
GCCACAACCACCGCCCAGGCCGCCCTGGGCATGTACCCGACGCTCCACGTCCCGGCCTCGACGGAGGAGCAGTTC
GCCGCCCAGGCCGTCGCCGAGGGCGATCACGGGCCCGACAACTCCTATAACCCCGACGTCACCCAGTCCGAGTCC
ATGATGGACGCCCAGCCCGTGAGTCCTAGCCAGCAGCATCAGGGTCCCCCCCCTCCCCCCGCCAACGGTATCCAG
TCCGGTCCCAGATACTCTACCTCTTCCAATGCCAAGCCCAGCGTCGGTTCCGAGGAGTGGCACAAGATGCGCAAG
GATAACCACAAGGAAGTGGAACGACGTCGCAGAGAGACCATCAACGAGGGCATCAACGAGTTGGCAAAGATCGTG
CCGGGCTGCGAAAAGAACAAGGGTTCCATTCTCCAACGAGCCGTCAGCTTCATATCGCAACTCAAGGAAAACGAG
CAGCAAAACATTGAAAAGTGGACGTTGGAAAAACTCCTCACCGAACAGGCCATCACCGAACTCAGCGCCTCAAAC
GACAAGCTCAAGCAGGAATGCGAGCGTCTCTACCGCGAACTCGAGACGTGGAAGCGCGTAGCCCAAAACGCTGGC
CTCGAACCGCCACAGCCAAAGGACGAGCCGGGCTCAACCGCGCCTCCCAGTTAG
Gene >Ophcf2|03643
ATGATCAGCGAGGTATGTATGCACGTTTTTCTTCAGTTCCCCCTTAAGAAATTCTTCCCTCAGTGCCGGCCTTTT
CGTCGTTCATCATGGATCATCTTGACTTCCCCCCGCTGCGTCTAAAGGCCGACCATGAAGTCTTCATCTGTCTCT
GTTCCTTACTGACAGACCATCTCGTCGTCCAGCCTTGCCAGCTCGCTGTCGACTCCCGCCCTTGCTCACAATGTC
GGAACCGGTCGCCACGGCCGAACAGCCAGAGATGTCGGCCCTGACCGGCTCTCCAGGACAGAAGCGAAAGCGAGA
GGCCGTCAGCCCCGGACTCCAGCGCGCCAAGCGGACGGCACCTCCCGCCGCCATGTCTGCCGACACCGCCGCCTT
CATCGAGAACGCCATAGAGGCCACCCAAGCCGCAGCCGCCAGCGGTGTCAGCGGTGTCAGCGGTGTCAGCGGTGT
CAGCGTCGCCGACTTCAGCGCCCTTCAGCAGGCCGCCGCTGCCGAACACTCCGAGTCGGCAGACCCGTCCAACGC
CACAACCACCGCCCAGGCCGCCCTGGGCATGTACCCGACGCTCCACGTCCCGGCCTCGACGGAGGAGCAGTTCGC
CGCCCAGGCCGTCGCCGAGGGCGATCACGGGCCCGACAACTCCTATAACCCCGACGTCACCCAGTCCGAGTCCAT
GATGGACGCCCAGCCCGTGAGTCCTAGCCAGCAGCATCAGGGTCCCCCCCCTCCCCCCGCCAACGGTATCCAGTC
CGGTCCCAGATACTCTACCTCTTCCAATGCCAAGCCCAGCGTCGGTTCCGAGGAGTGGCACAAGATGCGCAAGGA
TAACCACAAGGAAGGCAAGGCATCCTCACAGAGCCCATCCAACCCCCAAGCTGACCCCCCCCCCCAGTGGAACGA
CGTCGCAGAGAGACCATCAACGAGGGCATCAACGAGTTGGCAAAGATCGTGCCGGGCTGCGAAAAGAACAAGGGT
TCCATTCTCCAACGAGCCGTCAGCTTCATATCGCAACTCAAGGAAAACGAGCAGCAAAACATTGAAAAGTGGACG
TTGGAAAAACTCCTCACCGAACAGGCCATCACCGAACTCAGCGCCTCAAACGACAAGCTCAAGCAGGAATGCGAG
CGTCTCTACCGCGAACTCGAGACGTGGAAGCGCGTAGCCCAAAACGCTGGCCTCGAACCGCCACAGCCAAAGGAC
GAGCCGGGCTCAACCGCGCCTCCCAGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail