Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03636
Gene name
Locationscaffold_03:3377314..3378105
Strand-
Gene length (bp)791
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family 5.6E-24 111 218

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 210 227 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 153.49 88.29 218.69
Alive In ants, during behavior modification 282.01 156.30 407.72
Dead In ants, recently dead 218.02 123.53 312.51

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000657 yes
Alive Dead 0.118192 no
Dead Fungus 0.057682 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03636
MSSLWNSLTGGSKQSQAQAHTAVQTRAVGQTSPGLAETDEPEPVNMPLSLTPGTDAYIIQRSAFSDPSLLHPLAG
LDKPSLEYLTLDESALSDLPGGQSVLPSRGFTDDLCYGTGITYLTALSIGGAWGLQEGLRRSDGQPPKLRLNSVL
NAVTRRGPFLGNSAGAVAITYNCINSLIGHLRGKHAASNSVLAGALSGMVFKSTRGLRPMMISGGIVGSIAAVWA
VFRRSVFPVPDRSAPITTM*
Coding >Ophcf2|03636
ATGTCGTCACTCTGGAACTCCCTCACGGGGGGCAGCAAGCAGTCACAGGCCCAGGCCCACACGGCAGTTCAGACC
CGGGCCGTGGGCCAGACATCGCCGGGCCTGGCCGAGACGGACGAGCCGGAGCCGGTCAATATGCCGCTGTCGCTG
ACGCCGGGGACGGACGCCTACATCATCCAGAGATCGGCTTTTTCCGATCCGTCGCTGCTGCATCCCCTCGCCGGC
CTCGACAAGCCGTCGCTCGAATACCTTACGCTCGACGAGTCGGCCCTGTCCGACCTACCGGGCGGTCAGTCGGTT
CTGCCGTCGCGGGGCTTCACCGATGATCTCTGCTACGGCACCGGCATCACATATCTGACGGCGCTTTCGATTGGT
GGTGCTTGGGGTCTGCAGGAGGGGTTACGCAGGTCTGACGGACAGCCGCCCAAGTTGCGGCTCAACTCTGTCCTC
AACGCCGTTACCAGGCGAGGGCCTTTTCTCGGGAATTCGGCTGGTGCGGTGGCCATTACCTATAACTGCATCAAC
TCGCTCATAGGTCACCTGCGCGGCAAGCACGCTGCTTCGAATAGCGTCTTGGCCGGCGCGTTGAGCGGCATGGTC
TTTAAAAGTACGCGGGGGTTGCGTCCCATGATGATCTCTGGTGGCATTGTGGGGTCTATCGCCGCTGTCTGGGCT
GTCTTTCGGCGAAGCGTGTTTCCCGTGCCGGATCGCAGTGCTCCGATCACGACGATGTGA
Transcript >Ophcf2|03636
ATGTCGTCACTCTGGAACTCCCTCACGGGGGGCAGCAAGCAGTCACAGGCCCAGGCCCACACGGCAGTTCAGACC
CGGGCCGTGGGCCAGACATCGCCGGGCCTGGCCGAGACGGACGAGCCGGAGCCGGTCAATATGCCGCTGTCGCTG
ACGCCGGGGACGGACGCCTACATCATCCAGAGATCGGCTTTTTCCGATCCGTCGCTGCTGCATCCCCTCGCCGGC
CTCGACAAGCCGTCGCTCGAATACCTTACGCTCGACGAGTCGGCCCTGTCCGACCTACCGGGCGGTCAGTCGGTT
CTGCCGTCGCGGGGCTTCACCGATGATCTCTGCTACGGCACCGGCATCACATATCTGACGGCGCTTTCGATTGGT
GGTGCTTGGGGTCTGCAGGAGGGGTTACGCAGGTCTGACGGACAGCCGCCCAAGTTGCGGCTCAACTCTGTCCTC
AACGCCGTTACCAGGCGAGGGCCTTTTCTCGGGAATTCGGCTGGTGCGGTGGCCATTACCTATAACTGCATCAAC
TCGCTCATAGGTCACCTGCGCGGCAAGCACGCTGCTTCGAATAGCGTCTTGGCCGGCGCGTTGAGCGGCATGGTC
TTTAAAAGTACGCGGGGGTTGCGTCCCATGATGATCTCTGGTGGCATTGTGGGGTCTATCGCCGCTGTCTGGGCT
GTCTTTCGGCGAAGCGTGTTTCCCGTGCCGGATCGCAGTGCTCCGATCACGACGATGTGA
Gene >Ophcf2|03636
ATGTCGTCACTCTGGAACTCCCTCACGGGGGGCAGCAAGCAGTCACAGGCCCAGGCCCACACGGCAGTTCAGACC
CGGGCCGTGGGCCAGACATCGCCGGGCCTGGCCGAGACGGACGAGCCGGAGCCGGTCAATATGCCGCTGTCGCTG
ACGCCGGGGACGGACGCCTACATCATCCAGAGATCGGCTTTTTCCGATCCGTCGCTGCTGCATCCCCTCGCCGGC
CTCGACAAGCCGTCGCTCGAATACCTTACGCTCGACGAGTCGGCCCTGTCCGACCTACCGGGCGGTCAGTCGGTT
CTGCCGTCGCGGGGCTTCACCGATGATCTCTGCTACGGCACCGGCATCACATATCTGACGGCGCTTTCGATTGGT
GGTGCTTGGGGTCTGCAGGAGGGGTTACGCAGGTCTGACGGACAGCCGCCCAAGTTGCGGCTCAACTCTGTCCTC
AACGCCGTTACCAGGCGAGGGCCTTTTCTCGGGAATTCGGCTGGTGCGGTGGCCATTACCTATAACTGCATCAAC
TCGCTCATAGGTCACCTGCGCGGCAAGCACGCTGCTTCGAATAGCGTCTTGGCCGGCGCGTTGAGCGGCATGGTC
TTTAAAAGTACGCGGGGGTTGCGTCCCATGATGATCTCTGGTGGCATTGTGGGGTCTATCGCCGCTGTCTGGGCT
GTAAGTCTTGGTGTGTTCGTGATCCGTCTTTGACGGGAACTGATGAAAGGGTCAAGGTCTTTCGGCGAAGCGTGT
TTCCCGTGCCGGATCGCAGTGCTCCGATCACGACGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail