Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03617
Gene name
Locationscaffold_03:3333451..3336181
Strand+
Gene length (bp)2730
Transcript length (bp)2574
Coding sequence length (bp)2574
Protein length (aa) 858

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 6.7E-73 433 707
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 5.1E-38 25 206
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 5.1E-34 226 422

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 108 125 17
3 182 204 22
4 437 459 22
5 479 501 22
6 522 544 22
7 581 603 22
8 624 646 22
9 651 673 22
10 686 708 22
11 713 735 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03617
MAHNETCKPEDYAKPPSKNQKDLEVQLILSLILGVSALVAFCILRPRWPALYSARKRRLEADMAPPALSNSSFGW
IPHLLRVTDEQVLASAGLDAFVFLSFFKMATRLFMAMSFFAVVVLWPINSHYRDFQIGLGEGQSPSNNSSVAAYY
HDLYGPIRPPLYGQVAALDSLPGSGEDKSRVRTYLWAYVVFTYFFVGLTLYVINRETFHIIEMRQKYLGSQSTIT
DRTFRLTGIPLEHRSEQKLKDMIEGLGIGLVDSVTLCRNWRQLDSLMAHRDITLRKLEAAWAQYLKQQQVDNKQH
SDSTQTANEEPDPDSNARLLASDTSRPHVTEGERPSINIRYGLLSLRSRRVDALDYYEEQLRRLDERVAEARHKE
YEATDMALITMDSVASCQMVVQARIDPRPGCFLTKLSPSPSDLVWRNTYSPRGIRRLKSWGITLFITVLTLIWIF
PTAILASWLSVCTIKTVLPSFFKWLSYHPIIYSLLQNGLPTLVVSLLNVAVPYLYDWLSNHQGMMSQGDVELSVI
SKNFFFTFFNTFFVFAISRTGFDFWSVLQKLLKDTSKIPAAIAADVEDLSIFYINFIMLQGVGLMPFRILEVGSV
FLYPIYRFFSSTPRDFAELQKPPVFQYGFYLPTALLVFNLCLIYSVLMWGFAILVFGTVYFLLGHLTFKYMVLYA
MDQPQHATGGAWRIICHRIVIGLVVFEVVMIGQIASLAAFVQSVTVLPLIPFTIWYSYYFKRRFEPLTKYIALRA
IGSGQPAQDGSGDDGESQPLRGLMRRQSTLDEYMEKDLVFVNPSLVTPLQQPWIYKDPPQPVSPEERAADAEQST
QTRPTLILPNADRSLGIGDDNVWADNNRGGRR*
Coding >Ophcf2|03617
ATGGCCCATAACGAGACGTGCAAACCCGAGGACTACGCCAAGCCACCGTCCAAGAACCAAAAGGACCTCGAGGTC
CAACTCATCCTCTCTCTGATTCTCGGAGTCTCGGCTCTCGTTGCCTTTTGCATATTGCGCCCGCGATGGCCTGCC
CTCTACTCTGCGCGCAAGCGCCGCCTCGAAGCAGACATGGCTCCTCCGGCTCTCTCAAATTCGAGCTTCGGCTGG
ATTCCTCACCTGCTGAGGGTCACGGACGAGCAAGTCCTGGCTTCCGCTGGGCTCGATGCCTTTGTCTTCCTGAGC
TTCTTCAAGATGGCGACGCGACTCTTCATGGCCATGTCATTCTTTGCCGTCGTTGTTCTCTGGCCCATCAACTCT
CATTATCGCGACTTTCAAATCGGCCTCGGTGAGGGCCAAAGTCCCAGCAACAACAGCAGCGTCGCAGCCTACTAT
CACGACCTGTACGGCCCCATCCGACCTCCTCTTTACGGCCAGGTAGCCGCGCTCGACTCGTTACCCGGATCTGGC
GAAGACAAGAGTCGCGTTCGGACGTACCTATGGGCCTACGTCGTCTTCACCTACTTCTTCGTCGGCCTGACTCTC
TACGTCATCAACCGGGAGACGTTTCACATCATCGAGATGCGGCAGAAATATTTGGGCTCCCAATCTACCATTACC
GATCGCACGTTTCGCCTGACGGGCATACCGCTGGAGCATCGATCCGAACAGAAGCTCAAGGATATGATCGAGGGG
CTCGGCATCGGCCTCGTCGACTCCGTCACGCTGTGCCGAAATTGGAGGCAGCTTGATTCCTTGATGGCGCATCGC
GATATAACTCTGCGAAAACTGGAGGCTGCTTGGGCTCAGTACCTTAAGCAACAGCAGGTTGACAACAAACAACAC
AGCGACTCTACTCAGACAGCCAACGAGGAGCCGGACCCCGACAGCAACGCCCGTCTGCTGGCGAGCGACACGAGC
CGGCCGCACGTTACCGAAGGTGAGCGGCCTTCGATCAATATCCGGTACGGGCTGCTCTCCCTGCGGAGCCGGAGA
GTCGACGCCTTGGACTACTACGAGGAGCAGCTCCGCCGGCTGGACGAAAGAGTTGCCGAGGCCCGCCACAAAGAG
TACGAGGCGACCGACATGGCCCTGATAACGATGGACTCGGTGGCCTCGTGCCAGATGGTGGTCCAAGCCCGGATC
GACCCTCGGCCGGGCTGCTTTTTGACCAAGCTGTCCCCGTCCCCGTCGGATCTGGTATGGAGGAACACGTATTCT
CCCCGCGGGATCCGGAGGCTCAAGTCGTGGGGTATCACATTGTTCATCACCGTTTTGACCTTGATCTGGATCTTC
CCCACGGCCATCCTCGCGTCTTGGCTCAGCGTCTGCACCATCAAGACAGTGCTGCCGTCGTTTTTCAAGTGGCTG
TCTTATCACCCCATCATCTATTCCCTCCTTCAGAACGGTCTTCCTACGCTCGTCGTGTCGCTGCTCAACGTGGCC
GTGCCTTATCTGTACGACTGGCTGTCGAATCACCAGGGGATGATGTCCCAGGGCGACGTCGAGCTGTCGGTGATA
TCCAAGAACTTCTTCTTCACCTTCTTCAACACCTTTTTCGTCTTTGCCATCTCGCGCACCGGCTTCGACTTTTGG
AGCGTGCTGCAGAAGTTGCTCAAGGACACGAGCAAGATTCCGGCGGCCATTGCGGCCGATGTCGAGGACTTGTCC
ATCTTTTACATCAACTTTATCATGCTCCAGGGCGTCGGTCTGATGCCGTTTCGCATCCTCGAGGTCGGCAGCGTG
TTTCTATACCCCATCTACCGGTTCTTCTCGTCGACGCCCCGCGACTTTGCCGAGCTTCAGAAGCCGCCCGTGTTC
CAGTACGGCTTCTACCTGCCGACGGCGCTACTCGTCTTCAACCTGTGCCTGATCTACAGCGTGCTCATGTGGGGA
TTCGCCATTCTCGTCTTCGGCACCGTCTATTTCCTGCTGGGACATCTCACGTTCAAGTACATGGTGTTGTACGCC
ATGGATCAGCCCCAGCACGCGACGGGTGGCGCGTGGCGCATAATATGCCATCGCATCGTCATCGGCCTCGTCGTC
TTCGAGGTGGTCATGATCGGACAGATTGCGTCGCTCGCGGCATTTGTGCAGTCGGTGACGGTACTGCCGCTCATC
CCCTTTACGATCTGGTACAGCTACTACTTCAAGCGGCGGTTCGAGCCCCTTACCAAGTACATTGCGCTGCGGGCC
ATCGGCAGTGGACAGCCTGCCCAGGACGGCTCCGGAGACGATGGCGAGTCGCAGCCGTTACGGGGGTTGATGAGG
AGACAGAGCACGCTGGACGAATACATGGAGAAGGATCTGGTGTTCGTGAACCCGAGCCTTGTCACGCCACTCCAG
CAGCCATGGATATACAAGGACCCGCCTCAGCCGGTGTCGCCGGAAGAGAGGGCCGCTGATGCCGAGCAATCTACT
CAGACGCGGCCGACTTTGATCCTTCCCAATGCGGACCGATCACTCGGCATCGGGGACGACAACGTGTGGGCCGAC
AATAACCGGGGAGGGAGGAGATGA
Transcript >Ophcf2|03617
ATGGCCCATAACGAGACGTGCAAACCCGAGGACTACGCCAAGCCACCGTCCAAGAACCAAAAGGACCTCGAGGTC
CAACTCATCCTCTCTCTGATTCTCGGAGTCTCGGCTCTCGTTGCCTTTTGCATATTGCGCCCGCGATGGCCTGCC
CTCTACTCTGCGCGCAAGCGCCGCCTCGAAGCAGACATGGCTCCTCCGGCTCTCTCAAATTCGAGCTTCGGCTGG
ATTCCTCACCTGCTGAGGGTCACGGACGAGCAAGTCCTGGCTTCCGCTGGGCTCGATGCCTTTGTCTTCCTGAGC
TTCTTCAAGATGGCGACGCGACTCTTCATGGCCATGTCATTCTTTGCCGTCGTTGTTCTCTGGCCCATCAACTCT
CATTATCGCGACTTTCAAATCGGCCTCGGTGAGGGCCAAAGTCCCAGCAACAACAGCAGCGTCGCAGCCTACTAT
CACGACCTGTACGGCCCCATCCGACCTCCTCTTTACGGCCAGGTAGCCGCGCTCGACTCGTTACCCGGATCTGGC
GAAGACAAGAGTCGCGTTCGGACGTACCTATGGGCCTACGTCGTCTTCACCTACTTCTTCGTCGGCCTGACTCTC
TACGTCATCAACCGGGAGACGTTTCACATCATCGAGATGCGGCAGAAATATTTGGGCTCCCAATCTACCATTACC
GATCGCACGTTTCGCCTGACGGGCATACCGCTGGAGCATCGATCCGAACAGAAGCTCAAGGATATGATCGAGGGG
CTCGGCATCGGCCTCGTCGACTCCGTCACGCTGTGCCGAAATTGGAGGCAGCTTGATTCCTTGATGGCGCATCGC
GATATAACTCTGCGAAAACTGGAGGCTGCTTGGGCTCAGTACCTTAAGCAACAGCAGGTTGACAACAAACAACAC
AGCGACTCTACTCAGACAGCCAACGAGGAGCCGGACCCCGACAGCAACGCCCGTCTGCTGGCGAGCGACACGAGC
CGGCCGCACGTTACCGAAGGTGAGCGGCCTTCGATCAATATCCGGTACGGGCTGCTCTCCCTGCGGAGCCGGAGA
GTCGACGCCTTGGACTACTACGAGGAGCAGCTCCGCCGGCTGGACGAAAGAGTTGCCGAGGCCCGCCACAAAGAG
TACGAGGCGACCGACATGGCCCTGATAACGATGGACTCGGTGGCCTCGTGCCAGATGGTGGTCCAAGCCCGGATC
GACCCTCGGCCGGGCTGCTTTTTGACCAAGCTGTCCCCGTCCCCGTCGGATCTGGTATGGAGGAACACGTATTCT
CCCCGCGGGATCCGGAGGCTCAAGTCGTGGGGTATCACATTGTTCATCACCGTTTTGACCTTGATCTGGATCTTC
CCCACGGCCATCCTCGCGTCTTGGCTCAGCGTCTGCACCATCAAGACAGTGCTGCCGTCGTTTTTCAAGTGGCTG
TCTTATCACCCCATCATCTATTCCCTCCTTCAGAACGGTCTTCCTACGCTCGTCGTGTCGCTGCTCAACGTGGCC
GTGCCTTATCTGTACGACTGGCTGTCGAATCACCAGGGGATGATGTCCCAGGGCGACGTCGAGCTGTCGGTGATA
TCCAAGAACTTCTTCTTCACCTTCTTCAACACCTTTTTCGTCTTTGCCATCTCGCGCACCGGCTTCGACTTTTGG
AGCGTGCTGCAGAAGTTGCTCAAGGACACGAGCAAGATTCCGGCGGCCATTGCGGCCGATGTCGAGGACTTGTCC
ATCTTTTACATCAACTTTATCATGCTCCAGGGCGTCGGTCTGATGCCGTTTCGCATCCTCGAGGTCGGCAGCGTG
TTTCTATACCCCATCTACCGGTTCTTCTCGTCGACGCCCCGCGACTTTGCCGAGCTTCAGAAGCCGCCCGTGTTC
CAGTACGGCTTCTACCTGCCGACGGCGCTACTCGTCTTCAACCTGTGCCTGATCTACAGCGTGCTCATGTGGGGA
TTCGCCATTCTCGTCTTCGGCACCGTCTATTTCCTGCTGGGACATCTCACGTTCAAGTACATGGTGTTGTACGCC
ATGGATCAGCCCCAGCACGCGACGGGTGGCGCGTGGCGCATAATATGCCATCGCATCGTCATCGGCCTCGTCGTC
TTCGAGGTGGTCATGATCGGACAGATTGCGTCGCTCGCGGCATTTGTGCAGTCGGTGACGGTACTGCCGCTCATC
CCCTTTACGATCTGGTACAGCTACTACTTCAAGCGGCGGTTCGAGCCCCTTACCAAGTACATTGCGCTGCGGGCC
ATCGGCAGTGGACAGCCTGCCCAGGACGGCTCCGGAGACGATGGCGAGTCGCAGCCGTTACGGGGGTTGATGAGG
AGACAGAGCACGCTGGACGAATACATGGAGAAGGATCTGGTGTTCGTGAACCCGAGCCTTGTCACGCCACTCCAG
CAGCCATGGATATACAAGGACCCGCCTCAGCCGGTGTCGCCGGAAGAGAGGGCCGCTGATGCCGAGCAATCTACT
CAGACGCGGCCGACTTTGATCCTTCCCAATGCGGACCGATCACTCGGCATCGGGGACGACAACGTGTGGGCCGAC
AATAACCGGGGAGGGAGGAGATGA
Gene >Ophcf2|03617
ATGGCCCATAACGAGACGTGCAAACCCGAGGACTACGCCAAGCCACCGTCCAAGAACCAAAAGGACCTCGAGGTC
CAACTCATCCTCTCTCTGATTCTCGGAGTCTCGGCTCTCGTTGCCTTTTGCGTGAGTGACTTTTATCTCGGCCAG
TTTATGCCCGCTGACGATGGACTCCTCCAAGATATTGCGCCCGCGATGGCCTGCCCTCTACTCTGCGCGCAAGCG
CCGCCTCGAAGCAGACATGGCTCCTCCGGCTCTCTCAAATTCGAGCTTCGGCTGGATTCCTCACCTGCTGAGGGT
CACGGACGAGCAAGTCCTGGCTTCCGCTGGGCTCGATGCCTTTGTCGTACGTCGCCGCCTACGCCACGACATGCA
GTAGCTGACAGGGCCCTAGTTCCTGAGCTTCTTCAAGATGGCGACGCGACTCTTCATGGCCATGTCATTCTTTGC
CGTCGTTGTTCTCTGGCCCATCAACTCTCATTATCGCGACTTTCAAATCGGCCTCGGTGAGGGCCAAAGTCCCAG
CAACAACAGCAGCGTCGCAGCCTACTATCACGACCTGTACGGCCCCATCCGACCTCCTCTTTACGGCCAGGTAGC
CGCGCTCGACTCGTTACCCGGATCTGGCGAAGACAAGAGTCGCGTTCGGACGTACCTATGGGCCTACGTCGTCTT
CACCTACTTCTTCGTCGGCCTGACTCTCTACGTCATCAACCGGGAGACGTTTCACATCATCGAGATGCGGCAGAA
ATATTTGGGCTCCCAATCTACCATTACCGATCGCACGTTTCGCCTGACGGGCATACCGCTGGAGCATCGATCCGA
ACAGAAGCTCAAGGATATGATCGAGGGGCTCGGCATCGGCCTCGTCGACTCCGTCACGCTGTGCCGAAATTGGAG
GCAGCTTGATTCCTTGATGGCGCATCGCGATATAACTCTGCGAAAACTGGAGGCTGCTTGGGCTCAGTACCTTAA
GCAACAGCAGGTTGACAACAAACAACACAGCGACTCTACTCAGACAGCCAACGAGGAGCCGGACCCCGACAGCAA
CGCCCGTCTGCTGGCGAGCGACACGAGCCGGCCGCACGTTACCGAAGGTGAGCGGCCTTCGATCAATATCCGGTA
CGGGCTGCTCTCCCTGCGGAGCCGGAGAGTCGACGCCTTGGACTACTACGAGGAGCAGCTCCGCCGGCTGGACGA
AAGAGTTGCCGAGGCCCGCCACAAAGAGTACGAGGCGACCGACATGGCCCTGATAACGATGGACTCGGTGGCCTC
GTGCCAGATGGTGGTCCAAGCCCGGATCGACCCTCGGCCGGGCTGCTTTTTGACCAAGCTGTCCCCGTCCCCGTC
GGATCTGGTATGGAGGAACACGTATTCTCCCCGCGGGATCCGGAGGCTCAAGTCGTGGGGTATCACATTGTTCAT
CACCGTTTTGACCTTGATCTGGATCTTCCCCACGGCCATCCTCGCGTCTTGGCTCAGCGTCTGCACCATCAAGAC
AGTGCTGCCGTCGTTTTTCAAGTGGCTGTCTTATCACCCCATCATCTATTCCCTCCTTCAGAACGGTCTTCCTAC
GCTCGTCGTGTCGCTGCTCAACGTGGCCGTGCCTTATCTGTACGACTGGCTGTCGAATCACCAGGGGATGATGTC
CCAGGGCGACGTCGAGCTGTCGGTGATATCCAAGAACTTCTTCTTCACCTTCTTCAACACCTTTTTCGTCTTTGC
CATCTCGCGCACCGGCTTCGACTTTTGGAGCGTGCTGCAGAAGTTGCTCAAGGACACGAGCAAGATTCCGGCGGC
CATTGCGGCCGATGTCGAGGACTTGTCCATCTTTTACATCAACTTTATCATGCTCCAGGGCGTCGGTCTGATGCC
GTTTCGCATCCTCGAGGTCGGCAGCGTGTTTCTATACCCCATCTACCGGTTCTTCTCGTCGACGCCCCGCGACTT
TGCCGAGCTTCAGAAGCCGCCCGTGTTCCAGTACGGCTTCTACCTGCCGACGGCGCTACTCGTCTTCAACCTGTG
CCTGATCTACAGCGTGCTCATGTGGGGATTCGCCATTCTCGTCTTCGGCACCGTCTATTTCCTGCTGGGACATCT
CACGTTCAAGTACATGGTGTTGTACGCCATGGATCAGCCCCAGCACGCGACGGGTGGCGCGTGGCGCATAATATG
CCATCGCATCGTCATCGGCCTCGTCGTCTTCGAGGTGGTCATGATCGGACAGATTGCGTCGCTCGCGGCATTTGT
GCAGTCGGTGACGGTACTGCCGCTCATCCCCTTTACGATCTGGTACAGCTACTACTTCAAGCGGCGGTTCGAGCC
CCTTACCAAGTACATTGCGCTGCGGGCCATCGGCAGTGGACAGCCTGCCCAGGACGGCTCCGGAGACGATGGCGA
GTCGCAGCCGTTACGGGGGTTGATGAGGAGACAGAGCACGCTGGACGAATACATGGAGAAGGATCTGGTGTTCGT
GAACCCGAGCCTTGTCACGCCGTAAGTCCAGATATCCCTGCGCTTGGGCGTATAACTGACTAAGATGTACATAGA
CTCCAGCAGCCATGGATATACAAGGACCCGCCTCAGCCGGTGTCGCCGGAAGAGAGGGCCGCTGATGCCGAGCAA
TCTACTCAGACGCGGCCGACTTTGATCCTTCCCAATGCGGACCGATCACTCGGCATCGGGGACGACAACGTGTGG
GCCGACAATAACCGGGGAGGGAGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail