Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03614
Gene name
Locationscaffold_03:3324955..3326055
Strand-
Gene length (bp)1100
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 6.1E-30 98 219

GO

GO Term Description Terminal node
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1217 0.0589 0.962 0.0855 0.0672 0.0103 0.182 0.1378 0.2055 0.0061

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999618

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CE4 2.9E-31 100 223

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup88
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3130
Ophiocordyceps australis 1348a (Ghana) OphauG2|438
Ophiocordyceps australis map64 (Brazil) OphauB2|1465
Ophiocordyceps australis map64 (Brazil) OphauB2|230
Ophiocordyceps camponoti-floridani Ophcf2|03614 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06957
Ophiocordyceps camponoti-floridani Ophcf2|05927
Ophiocordyceps camponoti-rufipedis Ophun1|481
Ophiocordyceps camponoti-rufipedis Ophun1|6139
Ophiocordyceps camponoti-rufipedis Ophun1|5221
Ophiocordyceps kimflemingae Ophio5|24
Ophiocordyceps kimflemingae Ophio5|7553
Ophiocordyceps kimflemingae Ophio5|7800
Ophiocordyceps subramaniannii Hirsu2|960
Ophiocordyceps subramaniannii Hirsu2|5438
Ophiocordyceps subramaniannii Hirsu2|3901
Ophiocordyceps subramaniannii Hirsu2|3201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03614
MVSFYLLSTLLSAALLVQATGNTAAEGCSSEREGSPASRNGGSTAGKGGSRSGGSNSESRKGGNSGSLEGGEASG
NKTSSGGSQTQKVQFGKIITNCTVPNSYALSFDDGPHIFTMEALDKLKAANKKATFFVNGDNFSKISERAPEVKR
MIAEGHQLGSHTFRHPDLTNITDDEIRTEMTLNDREIKKIIGKTPTYMRPPFFSTDDRSIKVLTDMQYKIINANI
DTKDFENLTPETNDKSFVTYQELFNEGGSISLMHDVHNTTVNQLLPNVIDFLSKTQRQLGECLGDPPENWYRDDT
INGKVVEGPTRRSLEPCSCGGLEKIA*
Coding >Ophcf2|03614
ATGGTTTCTTTCTATCTTTTGAGCACGCTGCTTTCCGCGGCGCTGCTCGTCCAGGCTACGGGCAATACGGCAGCG
GAAGGCTGTTCCAGTGAACGAGAAGGCTCTCCAGCCTCCAGAAACGGAGGAAGCACTGCGGGAAAGGGAGGCTCC
AGAAGCGGAGGAAGCAACTCTGAATCTCGCAAAGGTGGAAATTCGGGATCCCTCGAAGGGGGAGAGGCTTCGGGA
AACAAGACGAGCAGCGGCGGTTCGCAAACGCAAAAAGTCCAGTTTGGCAAGATCATCACCAACTGCACCGTTCCA
AACTCGTACGCCCTCAGCTTCGACGATGGGCCGCACATCTTCACCATGGAAGCGCTGGATAAGCTCAAGGCGGCG
AACAAGAAGGCTACCTTTTTCGTCAACGGCGACAACTTCAGCAAGATCTCGGAGAGGGCGCCCGAGGTTAAGCGG
ATGATTGCCGAGGGTCATCAGCTGGGATCTCATACGTTTCGGCATCCGGATCTGACCAACATCACCGATGATGAG
ATCAGGACTGAGATGACGTTGAACGACAGGGAAATCAAGAAGATTATCGGAAAGACGCCGACTTACATGCGACCC
CCTTTCTTCAGCACCGACGATCGTTCCATCAAGGTCCTGACCGACATGCAATACAAGATCATAAACGCCAACATC
GACACAAAGGACTTTGAGAACCTAACGCCCGAGACCAACGACAAGTCCTTCGTGACCTACCAAGAGCTCTTCAAC
GAGGGAGGATCCATCTCTCTCATGCACGACGTCCACAACACGACAGTCAACCAGCTGCTTCCCAATGTCATCGAC
TTTCTGTCCAAGACGCAGAGGCAATTGGGAGAGTGTCTTGGAGACCCCCCGGAGAACTGGTATCGCGATGATACG
ATCAATGGCAAGGTTGTCGAGGGGCCGACCCGACGGTCCCTGGAGCCCTGCAGCTGCGGCGGTCTTGAGAAAATT
GCGTGA
Transcript >Ophcf2|03614
ATGGTTTCTTTCTATCTTTTGAGCACGCTGCTTTCCGCGGCGCTGCTCGTCCAGGCTACGGGCAATACGGCAGCG
GAAGGCTGTTCCAGTGAACGAGAAGGCTCTCCAGCCTCCAGAAACGGAGGAAGCACTGCGGGAAAGGGAGGCTCC
AGAAGCGGAGGAAGCAACTCTGAATCTCGCAAAGGTGGAAATTCGGGATCCCTCGAAGGGGGAGAGGCTTCGGGA
AACAAGACGAGCAGCGGCGGTTCGCAAACGCAAAAAGTCCAGTTTGGCAAGATCATCACCAACTGCACCGTTCCA
AACTCGTACGCCCTCAGCTTCGACGATGGGCCGCACATCTTCACCATGGAAGCGCTGGATAAGCTCAAGGCGGCG
AACAAGAAGGCTACCTTTTTCGTCAACGGCGACAACTTCAGCAAGATCTCGGAGAGGGCGCCCGAGGTTAAGCGG
ATGATTGCCGAGGGTCATCAGCTGGGATCTCATACGTTTCGGCATCCGGATCTGACCAACATCACCGATGATGAG
ATCAGGACTGAGATGACGTTGAACGACAGGGAAATCAAGAAGATTATCGGAAAGACGCCGACTTACATGCGACCC
CCTTTCTTCAGCACCGACGATCGTTCCATCAAGGTCCTGACCGACATGCAATACAAGATCATAAACGCCAACATC
GACACAAAGGACTTTGAGAACCTAACGCCCGAGACCAACGACAAGTCCTTCGTGACCTACCAAGAGCTCTTCAAC
GAGGGAGGATCCATCTCTCTCATGCACGACGTCCACAACACGACAGTCAACCAGCTGCTTCCCAATGTCATCGAC
TTTCTGTCCAAGACGCAGAGGCAATTGGGAGAGTGTCTTGGAGACCCCCCGGAGAACTGGTATCGCGATGATACG
ATCAATGGCAAGGTTGTCGAGGGGCCGACCCGACGGTCCCTGGAGCCCTGCAGCTGCGGCGGTCTTGAGAAAATT
GCGTGA
Gene >Ophcf2|03614
ATGGTTTCTTTCTATCTTTTGAGCACGCTGCTTTCCGCGGCGCTGCTCGTCCAGGCTACGGGCAATACGGCAGCG
GAAGGCTGTTCCAGTGAACGAGAAGGCTCTCCAGCCTCCAGAAACGGAGGAAGCACTGCGGGAAAGGGAGGCTCC
AGAAGCGGAGGAAGCAACTCTGAATCTCGCAAAGGTGGAAATTCGGGATCCCTCGAAGGGGGAGAGGCTTCGGGA
AACAAGACGAGCAGCGGCGGTTCGCAAACGCAAAAAGTCCAGTTTGGCAAGATCATCACCAACTGCACCGTTCCA
AACTCGTACGCCCTCAGCTTCGACGATGGGCCGCACATCTTCACCATGGAAGCGCTGGATAAGCTCAAGGCGGCG
AACAAGAAGGCTACCTTTTTCGTCAACGGCGACAACTTCAGCAAGATCTCGGAGAGGGCGCCCGAGGTTAAGCGG
ATGATTGCCGAGGGTCATCAGCTGGGATCTCATACGTTTGTCTGCCTTGACGATTGTGAAGTGTTGAAGTAGATG
CTGACGATTGCAGGTTTCGGCATCCGGATCTGACCAACATCACCGATGATGAGATCAGGACTGAGATGACGTTGA
ACGACAGGGAAATCAAGAAGATTATCGGAAAGACGCCGACTTACATGCGACCCCCTTTCTTCAGCACCGACGATC
GTTCCATCAAGGTCCTGACCGACATGCAATACAAGATCATAAACGCCAACATCGACACAAAGGACTTTGAGAACC
TAACGCCCGAGACCAACGACAAGTCCTTCGTGACCTACCAAGAGCTCTTCAACGAGGGAGGATCCATCTCTCTCA
TGCACGACGTCCACAACACGACAGTCAACCAGCTGCTTCCCAATGTCATCGACTTTCTGTCCAAGACGCAGAGGC
AATGTAAGTCACAGCCTTAGCCTTCTCTCCGACGCAACCGGTGCCCTGACTCTGCCTCAGCTTTGACAGTGGGAG
AGTGTCTTGGAGACCCCCCGGAGAACTGGTATCGCGATGATACGATCAATGGCAAGGTTGTCGAGGGGCCGACCC
GACGGTCCCTGGAGCCCTGCAGCTGCGGCGGTCTTGAGAAAATTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail