Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03608
Gene name
Locationscaffold_03:3275683..3280613
Strand+
Gene length (bp)4930
Transcript length (bp)4713
Coding sequence length (bp)4713
Protein length (aa) 1571

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14701 hDGE_amylase Glycogen debranching enzyme, glucanotransferase domain 4.7E-175 142 586
PF06202 GDE_C Amylo-alpha-1,6-glucosidase 3.8E-119 1069 1538
PF14702 hGDE_central Central domain of human glycogen debranching enzyme 9.5E-88 746 990
PF14699 hGDE_N N-terminal domain from the human glycogen debranching enzyme 1.6E-29 41 138

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4804 0.4983 0.0989 0.0255 0.2825 0.0154 0.2329 0.1681 0.1913 0.0349

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH13_25 3.5E-197 1087 1538

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3993
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7642
Ophiocordyceps australis map64 (Brazil) OphauB2|6793
Ophiocordyceps camponoti-floridani Ophcf2|03608 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3549
Ophiocordyceps kimflemingae Ophio5|32
Ophiocordyceps subramaniannii Hirsu2|7987

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03608
MSPRTMTSNEVYLLRLNDDGSPQVPGEYIYLAPSAADVVTLRFAIEGTSSICRHGSLWVNVPEKGQPFRRDSFRE
FELKPDFNRTIDISVPIHQAGAFAFYTTYAKLPSLEPSLASESPPVLSRTPLYYIDVAPRLRLDGRPLPLPALSL
FSVIGKFMGAYPGDWERHLRGISERGYNMVHFTPLQRRGRSNSPFSLYDQLAWDPACFPRGETDVRELVDSMERN
HSLLSLTDIVLNHTADNSPWLHHHPEAGYNLSTAPWLESAYELDTRLLQLSCELTSKGLPVHIKSTDDLMRIMEA
IKTDVIAKIKLWEYYAVDVERDADAAVDAWARGETMTSEQVPVCDEVVDKLRKASLLDREESLADRVSFLRQHGM
TGLDRLGERHRRRVDAKAAATLLSHAFARDEDDKAAVRADMVKMLDALNVDLYKEYDTDVDEMLQQLFNRIKYVR
LDDHGPKLGPIDDKNPLIESYFTRLPHNDVTSKHGPRDLALVNNGWVWGGNALVDNAGPDSRVYLRREVIVWGDC
VKLRYGEAPRDSPWLWQHMTAYSRMLAKYFAGFRIDNCHSTPLHVAEHMLDEARCVRPDLYVVAELFTGSEEMDY
VFVKRLGISSLIREAMQAWSTAELSRLVHKHGGRPIGSFEIDDIARAAPELANGQRSREIVRRIKATPVHALLMD
CTHDNETPAQKRDARDTLPNAALVSMCASATGSVMGYDDIYPRLVDLVSETRLYAPDSAGPGSTSKRQERGIGAV
RKILNQIHTLMGKDGYDETHVHHEEQYITVHRVHPESRKGYFLIAHTAFPGYGNGNGALGPVHLTGTRARHLGSW
MLEVEAGEEATRQTLADANYLRGLPSRLVDVAGIRMETPGDDTVITVRDKFPPGSIALFETWIPAAEHSAGLDTY
VTSGAEAAWAELGLVDLNFVMYRCEAEELDASDGQDGTYDVPGHGKLVYAGLQGWWSVLRDVMRENNLAHPLCQN
LRDGQWALDYVLGRLERAGKTAASGGNSWRLARPTAWLRERFDAIRTVPSFLLPRYFGLVLRTAHRASRQRAMEL
MGAGIRGGQWFLQSLAMVSVQQTGYVKSASLWPDKSVPCLAAGLPHFSVEWARCWGRDVFISIRGLYLGTGRFCE
AREHILAFASVLKHGMIPNLLSSGDNPRYNARDAVWFFLQAIQDYVRLAPDGTRLLGEKVRRRFLPYDDTWFPTT
DARAYSKESSVADVIQEALQRHASGIQFREANAGPQIDSQMKDEGFNQHVWVDWDTGIVFGGNQHNCGTWMDKMG
ESERAGTKGVPGTPRDGAAIEMTGLLYSTLAWLARLHGEGSYGPSGVTTAEGLSVSFSDWAARIKDNFERCYWVP
ASAAEDGEYSIRPGIVNRRGIYKDLYRSGKEYEDYQLRPNFAVAMAVAPALFDGEHAMKALCLADSVLRGPCGMA
TLDPADLNYRPYYRNSDDSDDAATGKGRNYHQGPEWLWPTGFFLRALLKFDLSRRTTAEGRTEAFQQVTRRLEGC
KRMMRHSPWAGLTELTQRDGELCPDSSPTQAWSASCLIDLYMDALEEQRGSEGCEIESPRGERDRVRAYW*
Coding >Ophcf2|03608
ATGAGCCCCCGCACCATGACGTCCAACGAGGTCTATCTGCTGCGGCTCAACGATGATGGCTCGCCGCAAGTCCCC
GGCGAATACATCTACTTGGCTCCATCGGCAGCCGACGTCGTGACGCTACGATTCGCCATCGAGGGCACCTCGTCC
ATCTGTCGCCATGGCAGCCTCTGGGTCAACGTGCCAGAAAAGGGACAGCCCTTTCGTCGCGATAGCTTCAGGGAG
TTTGAGCTCAAGCCCGACTTCAATCGTACCATCGACATCTCCGTACCGATCCACCAGGCCGGCGCCTTTGCCTTT
TATACCACCTACGCCAAGCTGCCGTCTCTCGAGCCCAGTCTCGCGTCAGAGTCTCCTCCGGTCCTGTCGAGGACG
CCGCTCTACTACATCGATGTGGCCCCGAGGCTACGACTCGACGGCCGTCCACTGCCGTTGCCCGCTCTCTCCCTC
TTCTCCGTCATAGGCAAGTTCATGGGCGCCTATCCCGGCGACTGGGAGCGTCACCTGCGCGGTATCAGCGAGCGC
GGCTACAACATGGTGCACTTTACGCCTCTGCAGCGTCGCGGCCGGTCCAATTCGCCCTTTAGCCTCTACGACCAG
CTGGCATGGGATCCTGCCTGCTTCCCTCGCGGAGAGACAGACGTGCGCGAACTGGTGGACAGCATGGAAAGGAAC
CATTCTCTCCTCAGCCTTACCGACATCGTCCTCAATCACACTGCCGACAACTCGCCCTGGCTGCACCACCACCCC
GAGGCCGGCTACAACCTGTCGACCGCGCCCTGGCTCGAGTCGGCCTACGAGTTGGATACCCGATTGCTCCAATTG
AGCTGCGAATTGACATCCAAGGGCCTGCCTGTCCATATCAAATCCACCGACGATTTGATGCGGATCATGGAAGCC
ATCAAGACGGACGTCATTGCCAAGATCAAGCTATGGGAGTACTACGCTGTCGATGTCGAGCGCGATGCCGATGCC
GCCGTCGATGCCTGGGCGCGCGGAGAGACCATGACCTCGGAACAGGTCCCCGTCTGCGACGAAGTCGTCGACAAG
CTTCGCAAGGCGTCCTTGTTAGACCGCGAAGAATCTCTGGCAGATCGCGTCTCCTTTCTGAGGCAACACGGCATG
ACGGGCTTGGATCGCTTGGGCGAGCGCCATCGACGTAGGGTCGACGCCAAGGCCGCGGCCACCTTGCTATCGCAC
GCCTTCGCACGGGACGAGGACGACAAGGCTGCCGTGAGGGCCGACATGGTCAAAATGCTGGACGCCTTGAACGTC
GACCTGTACAAGGAGTACGACACCGACGTCGACGAGATGCTGCAGCAGCTCTTCAACCGCATCAAGTATGTGCGC
CTCGACGACCACGGCCCCAAGCTGGGCCCCATCGACGACAAGAACCCCCTGATCGAGAGCTACTTCACGCGGCTT
CCACACAACGACGTCACGTCCAAGCACGGCCCTCGAGACCTGGCACTGGTCAACAACGGATGGGTATGGGGTGGA
AACGCGCTCGTCGACAATGCCGGCCCCGACTCTCGCGTCTACCTGCGGCGAGAGGTGATTGTGTGGGGAGACTGC
GTCAAGCTTCGGTACGGCGAGGCGCCCCGAGATAGCCCCTGGCTGTGGCAGCACATGACGGCCTACTCGCGCATG
TTGGCCAAGTACTTTGCCGGCTTCCGCATCGACAACTGCCACTCGACGCCGCTCCACGTGGCCGAGCACATGTTG
GACGAGGCCCGCTGCGTGCGGCCCGACCTGTACGTGGTCGCCGAGCTCTTCACGGGGTCGGAAGAGATGGACTAT
GTGTTCGTCAAGCGCCTGGGAATCAGCTCGCTGATCCGCGAGGCCATGCAGGCATGGAGTACGGCCGAGCTGAGC
AGGCTGGTACACAAGCACGGCGGCCGGCCCATCGGGAGCTTCGAGATCGACGACATTGCACGCGCTGCCCCGGAG
CTTGCCAACGGCCAGCGGTCTCGAGAGATCGTGCGACGGATCAAGGCCACGCCCGTCCACGCGCTGCTGATGGAC
TGCACGCACGACAACGAAACGCCGGCGCAGAAGCGCGACGCCCGCGATACGCTGCCCAACGCGGCCCTCGTCAGC
ATGTGCGCCAGCGCCACGGGCAGCGTCATGGGCTACGACGACATCTACCCGCGTCTCGTCGACCTAGTGAGCGAG
ACGCGCCTGTACGCGCCCGACTCGGCCGGCCCGGGATCGACCAGCAAGCGACAAGAGCGCGGCATTGGTGCCGTC
CGAAAGATCCTCAACCAGATACACACGCTCATGGGTAAGGACGGCTACGACGAGACGCACGTTCATCACGAGGAG
CAGTACATCACCGTCCACCGCGTTCATCCCGAGTCTCGCAAGGGCTACTTTCTCATCGCCCACACAGCCTTTCCC
GGCTACGGCAACGGTAACGGCGCCCTCGGCCCCGTCCACCTGACTGGCACGCGGGCCCGCCACCTCGGCAGCTGG
ATGCTCGAGGTGGAAGCCGGCGAAGAGGCGACGAGGCAGACGCTGGCCGACGCCAACTATCTCCGCGGCCTGCCC
AGCCGCCTTGTCGACGTGGCGGGCATCCGGATGGAGACGCCCGGCGACGACACCGTCATCACGGTCCGCGATAAG
TTCCCGCCCGGGAGCATCGCCCTCTTCGAGACGTGGATCCCCGCCGCCGAACACTCGGCCGGCCTCGACACGTAC
GTGACGTCGGGCGCAGAGGCCGCCTGGGCCGAGCTCGGGCTGGTGGACCTCAACTTTGTCATGTACCGGTGCGAG
GCCGAGGAGCTCGACGCCAGCGACGGTCAAGATGGCACCTATGACGTTCCCGGCCACGGAAAGCTCGTCTACGCC
GGCCTGCAGGGCTGGTGGAGCGTGCTGCGGGACGTGATGCGCGAGAACAACCTCGCCCATCCGCTCTGCCAGAAT
CTCCGCGACGGCCAGTGGGCGCTCGACTATGTCCTCGGGCGACTGGAGCGGGCTGGCAAGACGGCGGCGTCTGGC
GGCAATAGCTGGCGCCTCGCCCGGCCGACGGCATGGCTCAGGGAACGCTTCGACGCCATCCGCACCGTCCCCAGC
TTCCTACTGCCGCGCTACTTCGGCCTCGTGTTGCGGACCGCCCACCGGGCCAGCCGGCAGAGGGCCATGGAGCTC
ATGGGCGCCGGCATCAGAGGCGGACAGTGGTTCCTACAGAGCCTGGCCATGGTCAGCGTGCAGCAGACGGGCTAC
GTCAAGTCGGCGTCGCTTTGGCCGGACAAGTCGGTTCCCTGCTTGGCGGCAGGCCTGCCTCACTTCTCCGTCGAG
TGGGCGCGTTGCTGGGGGCGCGACGTCTTCATATCCATCCGCGGGCTGTACCTCGGCACCGGCCGCTTCTGCGAG
GCCAGGGAGCATATCCTGGCCTTTGCTAGCGTGCTGAAACACGGCATGATACCCAACCTGCTGAGCAGCGGCGAC
AACCCGCGATACAATGCGCGGGACGCCGTCTGGTTCTTCCTGCAGGCCATCCAGGACTATGTTCGCCTCGCGCCG
GACGGGACGCGTCTACTGGGGGAAAAGGTGCGGAGGAGATTTCTGCCATACGACGATACTTGGTTCCCGACGACG
GACGCGCGGGCCTATTCGAAGGAGAGCTCGGTGGCGGACGTGATTCAGGAGGCCCTGCAGCGGCACGCGTCCGGG
ATTCAATTCCGGGAGGCTAACGCGGGGCCTCAGATCGACTCGCAGATGAAGGACGAGGGCTTCAACCAGCACGTC
TGGGTCGACTGGGATACGGGCATCGTCTTTGGCGGCAATCAGCACAACTGCGGCACCTGGATGGACAAGATGGGC
GAGAGCGAGAGGGCGGGGACCAAAGGCGTGCCGGGGACGCCACGCGACGGAGCGGCCATCGAGATGACGGGTCTC
CTCTACAGCACCCTGGCGTGGCTGGCACGGCTGCACGGAGAAGGCTCGTACGGGCCGTCGGGGGTGACGACGGCT
GAGGGCCTCTCGGTGTCCTTTTCGGACTGGGCGGCTCGGATCAAGGACAACTTTGAGCGGTGCTACTGGGTCCCG
GCTTCGGCGGCGGAGGACGGAGAGTACTCGATCCGACCCGGAATCGTCAACCGGCGCGGCATCTACAAGGACCTT
TACCGGTCCGGCAAGGAGTACGAGGACTACCAGCTGCGGCCCAACTTTGCGGTGGCCATGGCGGTGGCGCCGGCG
CTCTTCGACGGCGAGCACGCCATGAAGGCGCTGTGCCTGGCCGACTCGGTGCTCCGCGGCCCGTGCGGTATGGCG
ACGCTGGACCCGGCCGATCTCAACTACCGGCCCTACTACCGCAACAGCGACGACAGCGACGACGCGGCCACCGGC
AAGGGACGCAACTATCACCAGGGGCCCGAGTGGCTCTGGCCCACCGGTTTCTTCCTGCGCGCCCTGCTCAAGTTC
GACCTGTCGAGGAGGACGACGGCCGAGGGTCGGACAGAGGCCTTTCAGCAGGTGACGCGCCGGCTCGAGGGCTGT
AAGCGCATGATGCGGCATAGTCCCTGGGCGGGCCTGACGGAGCTGACGCAGCGGGATGGAGAGCTGTGTCCGGAT
TCGAGTCCGACGCAGGCGTGGTCGGCCAGCTGCCTGATCGACCTGTACATGGACGCTCTGGAGGAGCAGCGAGGA
AGTGAGGGATGCGAGATAGAATCCCCTAGGGGCGAGCGAGACAGGGTCAGGGCGTATTGGTAG
Transcript >Ophcf2|03608
ATGAGCCCCCGCACCATGACGTCCAACGAGGTCTATCTGCTGCGGCTCAACGATGATGGCTCGCCGCAAGTCCCC
GGCGAATACATCTACTTGGCTCCATCGGCAGCCGACGTCGTGACGCTACGATTCGCCATCGAGGGCACCTCGTCC
ATCTGTCGCCATGGCAGCCTCTGGGTCAACGTGCCAGAAAAGGGACAGCCCTTTCGTCGCGATAGCTTCAGGGAG
TTTGAGCTCAAGCCCGACTTCAATCGTACCATCGACATCTCCGTACCGATCCACCAGGCCGGCGCCTTTGCCTTT
TATACCACCTACGCCAAGCTGCCGTCTCTCGAGCCCAGTCTCGCGTCAGAGTCTCCTCCGGTCCTGTCGAGGACG
CCGCTCTACTACATCGATGTGGCCCCGAGGCTACGACTCGACGGCCGTCCACTGCCGTTGCCCGCTCTCTCCCTC
TTCTCCGTCATAGGCAAGTTCATGGGCGCCTATCCCGGCGACTGGGAGCGTCACCTGCGCGGTATCAGCGAGCGC
GGCTACAACATGGTGCACTTTACGCCTCTGCAGCGTCGCGGCCGGTCCAATTCGCCCTTTAGCCTCTACGACCAG
CTGGCATGGGATCCTGCCTGCTTCCCTCGCGGAGAGACAGACGTGCGCGAACTGGTGGACAGCATGGAAAGGAAC
CATTCTCTCCTCAGCCTTACCGACATCGTCCTCAATCACACTGCCGACAACTCGCCCTGGCTGCACCACCACCCC
GAGGCCGGCTACAACCTGTCGACCGCGCCCTGGCTCGAGTCGGCCTACGAGTTGGATACCCGATTGCTCCAATTG
AGCTGCGAATTGACATCCAAGGGCCTGCCTGTCCATATCAAATCCACCGACGATTTGATGCGGATCATGGAAGCC
ATCAAGACGGACGTCATTGCCAAGATCAAGCTATGGGAGTACTACGCTGTCGATGTCGAGCGCGATGCCGATGCC
GCCGTCGATGCCTGGGCGCGCGGAGAGACCATGACCTCGGAACAGGTCCCCGTCTGCGACGAAGTCGTCGACAAG
CTTCGCAAGGCGTCCTTGTTAGACCGCGAAGAATCTCTGGCAGATCGCGTCTCCTTTCTGAGGCAACACGGCATG
ACGGGCTTGGATCGCTTGGGCGAGCGCCATCGACGTAGGGTCGACGCCAAGGCCGCGGCCACCTTGCTATCGCAC
GCCTTCGCACGGGACGAGGACGACAAGGCTGCCGTGAGGGCCGACATGGTCAAAATGCTGGACGCCTTGAACGTC
GACCTGTACAAGGAGTACGACACCGACGTCGACGAGATGCTGCAGCAGCTCTTCAACCGCATCAAGTATGTGCGC
CTCGACGACCACGGCCCCAAGCTGGGCCCCATCGACGACAAGAACCCCCTGATCGAGAGCTACTTCACGCGGCTT
CCACACAACGACGTCACGTCCAAGCACGGCCCTCGAGACCTGGCACTGGTCAACAACGGATGGGTATGGGGTGGA
AACGCGCTCGTCGACAATGCCGGCCCCGACTCTCGCGTCTACCTGCGGCGAGAGGTGATTGTGTGGGGAGACTGC
GTCAAGCTTCGGTACGGCGAGGCGCCCCGAGATAGCCCCTGGCTGTGGCAGCACATGACGGCCTACTCGCGCATG
TTGGCCAAGTACTTTGCCGGCTTCCGCATCGACAACTGCCACTCGACGCCGCTCCACGTGGCCGAGCACATGTTG
GACGAGGCCCGCTGCGTGCGGCCCGACCTGTACGTGGTCGCCGAGCTCTTCACGGGGTCGGAAGAGATGGACTAT
GTGTTCGTCAAGCGCCTGGGAATCAGCTCGCTGATCCGCGAGGCCATGCAGGCATGGAGTACGGCCGAGCTGAGC
AGGCTGGTACACAAGCACGGCGGCCGGCCCATCGGGAGCTTCGAGATCGACGACATTGCACGCGCTGCCCCGGAG
CTTGCCAACGGCCAGCGGTCTCGAGAGATCGTGCGACGGATCAAGGCCACGCCCGTCCACGCGCTGCTGATGGAC
TGCACGCACGACAACGAAACGCCGGCGCAGAAGCGCGACGCCCGCGATACGCTGCCCAACGCGGCCCTCGTCAGC
ATGTGCGCCAGCGCCACGGGCAGCGTCATGGGCTACGACGACATCTACCCGCGTCTCGTCGACCTAGTGAGCGAG
ACGCGCCTGTACGCGCCCGACTCGGCCGGCCCGGGATCGACCAGCAAGCGACAAGAGCGCGGCATTGGTGCCGTC
CGAAAGATCCTCAACCAGATACACACGCTCATGGGTAAGGACGGCTACGACGAGACGCACGTTCATCACGAGGAG
CAGTACATCACCGTCCACCGCGTTCATCCCGAGTCTCGCAAGGGCTACTTTCTCATCGCCCACACAGCCTTTCCC
GGCTACGGCAACGGTAACGGCGCCCTCGGCCCCGTCCACCTGACTGGCACGCGGGCCCGCCACCTCGGCAGCTGG
ATGCTCGAGGTGGAAGCCGGCGAAGAGGCGACGAGGCAGACGCTGGCCGACGCCAACTATCTCCGCGGCCTGCCC
AGCCGCCTTGTCGACGTGGCGGGCATCCGGATGGAGACGCCCGGCGACGACACCGTCATCACGGTCCGCGATAAG
TTCCCGCCCGGGAGCATCGCCCTCTTCGAGACGTGGATCCCCGCCGCCGAACACTCGGCCGGCCTCGACACGTAC
GTGACGTCGGGCGCAGAGGCCGCCTGGGCCGAGCTCGGGCTGGTGGACCTCAACTTTGTCATGTACCGGTGCGAG
GCCGAGGAGCTCGACGCCAGCGACGGTCAAGATGGCACCTATGACGTTCCCGGCCACGGAAAGCTCGTCTACGCC
GGCCTGCAGGGCTGGTGGAGCGTGCTGCGGGACGTGATGCGCGAGAACAACCTCGCCCATCCGCTCTGCCAGAAT
CTCCGCGACGGCCAGTGGGCGCTCGACTATGTCCTCGGGCGACTGGAGCGGGCTGGCAAGACGGCGGCGTCTGGC
GGCAATAGCTGGCGCCTCGCCCGGCCGACGGCATGGCTCAGGGAACGCTTCGACGCCATCCGCACCGTCCCCAGC
TTCCTACTGCCGCGCTACTTCGGCCTCGTGTTGCGGACCGCCCACCGGGCCAGCCGGCAGAGGGCCATGGAGCTC
ATGGGCGCCGGCATCAGAGGCGGACAGTGGTTCCTACAGAGCCTGGCCATGGTCAGCGTGCAGCAGACGGGCTAC
GTCAAGTCGGCGTCGCTTTGGCCGGACAAGTCGGTTCCCTGCTTGGCGGCAGGCCTGCCTCACTTCTCCGTCGAG
TGGGCGCGTTGCTGGGGGCGCGACGTCTTCATATCCATCCGCGGGCTGTACCTCGGCACCGGCCGCTTCTGCGAG
GCCAGGGAGCATATCCTGGCCTTTGCTAGCGTGCTGAAACACGGCATGATACCCAACCTGCTGAGCAGCGGCGAC
AACCCGCGATACAATGCGCGGGACGCCGTCTGGTTCTTCCTGCAGGCCATCCAGGACTATGTTCGCCTCGCGCCG
GACGGGACGCGTCTACTGGGGGAAAAGGTGCGGAGGAGATTTCTGCCATACGACGATACTTGGTTCCCGACGACG
GACGCGCGGGCCTATTCGAAGGAGAGCTCGGTGGCGGACGTGATTCAGGAGGCCCTGCAGCGGCACGCGTCCGGG
ATTCAATTCCGGGAGGCTAACGCGGGGCCTCAGATCGACTCGCAGATGAAGGACGAGGGCTTCAACCAGCACGTC
TGGGTCGACTGGGATACGGGCATCGTCTTTGGCGGCAATCAGCACAACTGCGGCACCTGGATGGACAAGATGGGC
GAGAGCGAGAGGGCGGGGACCAAAGGCGTGCCGGGGACGCCACGCGACGGAGCGGCCATCGAGATGACGGGTCTC
CTCTACAGCACCCTGGCGTGGCTGGCACGGCTGCACGGAGAAGGCTCGTACGGGCCGTCGGGGGTGACGACGGCT
GAGGGCCTCTCGGTGTCCTTTTCGGACTGGGCGGCTCGGATCAAGGACAACTTTGAGCGGTGCTACTGGGTCCCG
GCTTCGGCGGCGGAGGACGGAGAGTACTCGATCCGACCCGGAATCGTCAACCGGCGCGGCATCTACAAGGACCTT
TACCGGTCCGGCAAGGAGTACGAGGACTACCAGCTGCGGCCCAACTTTGCGGTGGCCATGGCGGTGGCGCCGGCG
CTCTTCGACGGCGAGCACGCCATGAAGGCGCTGTGCCTGGCCGACTCGGTGCTCCGCGGCCCGTGCGGTATGGCG
ACGCTGGACCCGGCCGATCTCAACTACCGGCCCTACTACCGCAACAGCGACGACAGCGACGACGCGGCCACCGGC
AAGGGACGCAACTATCACCAGGGGCCCGAGTGGCTCTGGCCCACCGGTTTCTTCCTGCGCGCCCTGCTCAAGTTC
GACCTGTCGAGGAGGACGACGGCCGAGGGTCGGACAGAGGCCTTTCAGCAGGTGACGCGCCGGCTCGAGGGCTGT
AAGCGCATGATGCGGCATAGTCCCTGGGCGGGCCTGACGGAGCTGACGCAGCGGGATGGAGAGCTGTGTCCGGAT
TCGAGTCCGACGCAGGCGTGGTCGGCCAGCTGCCTGATCGACCTGTACATGGACGCTCTGGAGGAGCAGCGAGGA
AGTGAGGGATGCGAGATAGAATCCCCTAGGGGCGAGCGAGACAGGGTCAGGGCGTATTGGTAG
Gene >Ophcf2|03608
ATGAGCCCCCGCACCATGACGTCCAACGAGGTCTATCTGCTGCGGCTCAACGATGATGGCTCGCCGCAAGTCCCC
GGCGAATACATCTACTTGGCTCCATCGGCAGCCGACGTCGTGACGCTACGATTCGCCATCGAGGGCACCTCGTCC
ATCTGTCGCCATGGCAGCCTCTGGGTCAACGTGCCAGAAAAGGGACAGCCCTTTCGTCGCGATAGCTTCAGGGAG
TTTGAGTAGGTCTGCCGGTAGCCTGCTGCCGGCCGTCCGTCGAGCTCACGTCCCGCCAGGCTCAAGCCCGACTTC
AATCGTACCATCGACATCTCCGTACCGATCCACCAGGCCGGCGCCTTTGCCTTTTATACCACCTACGCCAAGCTG
CCGTCTCTCGAGCCCAGTCTCGCGTCAGAGTCTCCTCCGGTCCTGTCGAGGACGCCGCTCTACTACATCGATGTG
GCCCCGAGGCTACGACTCGACGGCCGTCCACTGCCGTTGCCCGCTCTCTCCCTCTTCTCCGTCATAGGCAAGTTC
ATGGGCGCCTATCCCGGCGACTGGGAGCGTCACCTGCGCGGTATCAGCGAGCGCGGCTACAACATGGTGCACTTT
ACGCCTCTGCAGCGTCGCGGCCGGTCCAATTCGCCCTTTAGCCTCTACGACCAGCTGGCATGGGATCCTGCCTGC
TTCCCTCGCGGAGAGACAGACGTGCGCGAACTGGTGGACAGCATGGAAAGGAACCATTCTCTCCTCAGCCTTACC
GACATCGTCCTCAATCACACTGCCGACAACTCGCCCTGGCTGCACCACCACCCCGAGGCCGGCTACAACCTGTCG
ACCGCGCCCTGGCTCGAGTCGGCCTACGAGTTGGATACCCGATTGCTCCAATTGAGCTGCGAATTGACATCCAAG
GGCCTGCCTGTCCATATCAAATCCACCGACGATTTGATGCGGATCATGGAAGCCATCAAGACGGACGTCATTGCC
AAGATCAAGCTATGGGAGTACTACGCTGTCGATGTCGAGCGCGATGCCGATGCCGCCGTCGATGCCTGGGCGCGC
GGAGAGACCATGACCTCGGAACAGGTCCCCGTCTGCGACGAAGTCGTCGACAAGCTTCGCAAGGCGTCCTTGTTA
GACCGCGAAGAATCTCTGGCAGATCGCGTCTCCTTTCTGAGGCAACACGGCATGACGGGCTTGGATCGCTTGGGC
GAGCGCCATCGACGTAGGGTCGACGCCAAGGCCGCGGCCACCTTGCTATCGCACGCCTTCGCACGGGACGAGGAC
GACAAGGCTGCCGTGAGGGCCGACATGGTCAAAATGCTGGACGCCTTGAACGTCGACCTGTACAAGGAGTACGAC
ACCGACGTCGACGAGATGCTGCAGCAGCTCTTCAACCGCATCAAGTATGTGCGCCTCGACGACCACGGCCCCAAG
CTGGGCCCCATCGACGACAAGAACCCCCTGATCGAGAGCTACTTCACGCGGCTTCCACACAACGACGTCACGTCC
AAGCACGGCCCTCGAGACCTGGCACTGGTCAACAACGGATGGGTATGGGGTGGAAACGCGCTCGTCGACAATGCC
GGCCCCGACTCTCGCGTCTACCTGCGGCGAGAGGTGATTGTGTGGGGAGACTGCGTCAAGCTTCGGTACGGCGAG
GCGCCCCGAGATAGCCCCTGGCTGTGGCAGCACATGACGGCCTACTCGCGCATGTTGGCCAAGTACTTTGCCGGC
TTCCGCATCGACAACTGCCACTCGACGCCGCTCCACGTGGCCGAGCACATGTTGGACGAGGCCCGCTGCGTGCGG
CCCGACCTGTACGTGGTCGCCGAGCTCTTCACGGGGTCGGAAGAGATGGACTATGTGTTCGTCAAGCGCCTGGGA
ATCAGCTCGCTGATCCGCGAGGCCATGCAGGCATGGAGTACGGCCGAGCTGAGCAGGCTGGTACACAAGCACGGC
GGCCGGCCCATCGGGAGCTTCGAGATCGACGACATTGCACGCGCTGCCCCGGAGCTTGCCAACGGCCAGCGGTCT
CGAGAGATCGTGCGACGGATCAAGGCCACGCCCGTCCACGCGCTGCTGATGGACTGCACGCACGACAACGAAACG
CCGGCGCAGAAGCGCGACGCCCGCGATACGCTGCCCAACGCGGCCCTCGTCAGCATGTGCGCCAGCGCCACGGGC
AGCGTCATGGGCTACGACGACATCTACCCGCGTCTCGTCGACCTAGTGAGCGAGACGCGCCTGTACGCGCCCGAC
TCGGCCGGCCCGGGATCGACCAGCAAGCGACAAGAGCGCGGCATTGGTGCCGTCCGAAAGATCCTCAACCAGATA
CACACGCTCATGGGTAAGGACGGCTACGACGAGACGCACGTTCATCACGAGGAGCAGTACATCACCGTCCACCGC
GTTCATCCCGAGTCTCGCAAGGGCTACTTTCTCATCGCCCACACAGCCTTTCCCGGCTACGGCAACGGTAACGGC
GCCCTCGGCCCCGTCCACCTGACTGGCACGCGGGCCCGCCACCTCGGCAGCTGGATGCTCGAGGTGGAAGCCGGC
GAAGAGGCGACGAGGCAGACGCTGGCCGACGCCAACTATCTCCGCGGCCTGCCCAGCCGCCTTGTCGACGTGGCG
GGCATCCGGATGGAGACGCCCGGCGACGACACCGTCATCACGGTCCGCGATAAGTTCCCGCCCGGGAGCATCGCC
CTCTTCGAGACGTGGATCCCCGCCGCCGAACACTCGGCCGGCCTCGACACGTACGTGACGTCGGGCGCAGAGGCC
GCCTGGGCCGAGCTCGGGCTGGTGGACCTCAACTTTGTCATGTACCGGTGCGAGGCCGAGGAGCTCGACGCCAGC
GACGGTCAAGATGGCACCTATGACGTTCCCGGCCACGGAAAGCTCGTCTACGCCGGCCTGCAGGGCTGGTGGAGC
GTGCTGCGGGACGTGATGCGCGAGAACAACCTCGCCCATCCGCTCTGCCAGAATCTCCGCGACGGCCAGTGGGCG
CTCGACTATGTCCTCGGGCGACTGGAGCGGGCTGGCAAGACGGCGGCGTCTGGCGGCAATAGCTGGCGCCTCGCC
CGGCCGACGGCATGGCTCAGGGAACGCTTCGACGCCATCCGCACCGTCCCCAGCTTCCTACTGCCGCGCTACTTC
GGCCTCGTGTTGCGGACCGCCCACCGGGCCAGCCGGCAGAGGGCCATGGAGCTCATGGGCGCCGGCATCAGAGGC
GGACAGTGGTTCCTACAGAGCCTGGCCATGGTCAGCGTGCAGCAGACGGGCTACGTCAAGTCGGCGTCGCTTTGG
CCGGACAAGTCGGTTCCCTGCTTGGCGGCAGGCCTGCCTCACTTCTCCGTCGAGTGGGCGCGTTGCTGGGGGCGC
GACGTCTTCATATCCATCCGCGGGCTGTACCTCGGCACCGGCCGCTTCTGCGAGGCCAGGGAGCATATCCTGGCC
TTTGCTAGCGTGCTGAAACACGGCATGATACCCAACCTGCTGAGCAGCGGCGACAACCCGCGATACAATGCGCGG
GACGCCGTCTGGTTCTTCCTGCAGGCCATCCAGGACTATGTTCGCCTCGCGCCGGACGGGACGCGTCTACTGGGG
GAAAAGGTGCGGAGGAGATTTCTGCCATACGACGATACTTGGTTCCCGACGACGGACGCGCGGGCCTATTCGAAG
GAGAGCTCGGTGGCGGACGTGATTCAGGAGGCCCTGCAGCGGCACGCGTCCGGGATTCAATTCCGGGAGGCTAAC
GCGGGGCCTCAGATCGACTCGCAGATGAAGGACGAGGGCTTCAACCAGCACGTCTGGGTCGACTGGGATACGGGC
ATCGTCTTTGGCGGCAATCAGCACAACTGCGGCACCTGGATGGACAAGATGGGCGAGAGCGAGAGGGCGGGGACC
AAAGGCGTGCCGGGGACGCCACGCGACGGAGCGGCCATCGAGATGACGGGTCTCCTCTACAGCACCCTGGCGTGG
CTGGCACGGCTGCACGGAGAAGGCTCGTACGGGCCGTCGGGGGTGACGACGGCTGAGGGCCTCTCGGTGTCCTTT
TCGGACTGGGCGGCTCGGATCAAGGACAACTTTGAGCGGTGCTACTGGGTCCCGGCTTCGGCGGCGGAGGACGGA
GAGTACTCGATCCGACCCGGAATCGTCAACCGGCGCGGCATCTACAAGGACCTTTACCGGTCCGGCAAGGAGTAC
GAGGACTACCAGCTGCGGCCCAACTTTGCGGTGGCCATGGCGGTGGCGCCGGCGCTCTTCGACGGCGAGCACGCC
ATGAAGGCGCTGTGCCTGGCCGACTCGGTGCTCCGCGGCCCGTGCGGTATGGCGACGCTGGACCCGGCCGATCTC
AACTACCGGCCCTACTACCGCAACAGCGACGACAGCGACGACGCGGCCACCGGCAAGGGACGCAACTATCACCAG
GGGCCCGAGTGGCTCTGGCCCACCGGTTTCTTCCTGCGCGCCCTGCTCAAGTTCGACCTGTCGAGGAGGACGACG
GCCGAGGGTCGGACAGAGGCCTTTCAGCAGGTGACGCGCCGGCTCGAGGGCTGTAAGCGCATGATGCGGCATAGT
CCCTGGGCGGGCCTGACGGAGCTGACGCAGCGGGATGGAGAGCTGTGTCCGGATTCGGTGAGTTTGGTCGTCCCC
CGGATCACCGACGACGGCTGACTGGTGGTGAACAGAGTCCGACGCAGGCGTGGTCGGCCAGCTGCCTGATCGACC
TGTACATGGACGCTCTGGAGGAGCAGCGAGGAAGTGAGGGATGCGAGGTAATGAATAGTACGAAGACATGACGGA
GACAAAAGGGGGAGGCCAAAGACAACGATGCTCGATGATGGAACGGACCGGGCCGCAGAAGGGCTGACGGCCGCG
ACAACAGATAGAATCCCCTAGGGGCGAGCGAGACAGGGTCAGGGCGTATTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail