Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03606
Gene name
Locationscaffold_03:3271374..3272673
Strand+
Gene length (bp)1299
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 6.1E-44 15 196
PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus 1.6E-41 274 420

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0004367 glycerol-3-phosphate dehydrogenase [NAD+] activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0046168 glycerol-3-phosphate catabolic process Yes
GO:0047952 glycerol-3-phosphate dehydrogenase [NAD(P)+] activity No
GO:0009056 catabolic process No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0046434 organophosphate catabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0071704 organic substance metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0003674 molecular_function No
GO:0052646 alditol phosphate metabolic process No
GO:0006072 glycerol-3-phosphate metabolic process No
GO:0000166 nucleotide binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0036094 small molecule binding No
GO:1901575 organic substance catabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5455 0.4412 0.0459 0.134 0.4134 0.0138 0.045 0.0839 0.0842 0.027

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5956
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5760
Ophiocordyceps australis map64 (Brazil) OphauB2|796
Ophiocordyceps camponoti-floridani Ophcf2|03606 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3547
Ophiocordyceps kimflemingae Ophio5|34

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03606
MSAPQLLGGHARKHKVTIVGSGNWGSTIAKIVAENTRLHQKVFEETVQMWVFEEDVVIPKTSKHYDAAVGERPQK
LTSVINSIHENVKYLPDITLPTNIVANPSIVDAVRDSTILIFNLPHQFIGKVCEQIRGHILPYARGISCIKGVNV
SDDGVSLFSEWIGDGLNIYVGALSGANIANEIAAEKWSETTIAYDPPPMDSRAPSPRSGSPLPSPGLVITEAQTD
GQHLHHRDARGRTSKTRLTPVPPQYPPLEHDCFRLLFHRPYFHVQMVSDVAGVSLGGALKNIVALAAGFVDGRGW
GDNAKAAIMRIGLMEMVKFGKEFFGETVQSSTFTETSAGVADLITSCSGGRNFRCARKAVDKGISVDEVEKQDLN
GQKLQGTTTAYEVNSFLQRRGLEKDYPLFTAVNDILRGKKQVDDIPRLVAVADGEQQ*
Coding >Ophcf2|03606
ATGTCTGCTCCTCAACTCCTCGGCGGACATGCCCGAAAGCACAAGGTCACCATCGTCGGCTCCGGCAACTGGGGC
TCGACCATTGCCAAGATCGTGGCCGAGAACACGCGTCTGCATCAGAAGGTCTTTGAGGAGACGGTTCAGATGTGG
GTGTTTGAGGAGGATGTCGTTATCCCCAAGACGTCCAAGCACTATGACGCGGCTGTCGGCGAGAGGCCCCAGAAG
CTCACGTCGGTCATCAACTCGATTCACGAGAACGTCAAGTATCTGCCTGACATCACGCTGCCAACTAACATCGTG
GCAAATCCATCCATCGTCGACGCCGTTCGCGACTCTACCATCCTCATCTTCAACCTGCCTCATCAGTTTATCGGC
AAGGTCTGCGAGCAGATCCGCGGCCACATTCTTCCCTACGCGCGCGGCATCAGCTGCATCAAGGGAGTCAACGTC
TCCGACGACGGCGTCAGCCTCTTCAGCGAGTGGATTGGTGACGGCTTGAACATTTACGTCGGCGCCCTCAGCGGT
GCCAACATCGCCAACGAGATCGCCGCAGAAAAATGGTCCGAGACCACCATCGCCTACGACCCGCCCCCTATGGAC
AGCCGCGCGCCCTCTCCGAGATCAGGCAGCCCCTTGCCCAGCCCGGGCCTTGTCATCACCGAGGCCCAGACTGAC
GGCCAGCACCTTCACCATCGCGACGCCCGAGGCCGCACCTCCAAGACGCGACTGACGCCCGTCCCCCCCCAATAT
CCGCCGTTGGAGCACGACTGCTTCCGTCTTCTCTTCCACCGGCCCTACTTTCACGTGCAGATGGTCTCGGACGTG
GCTGGCGTGTCGCTCGGAGGCGCCCTCAAGAACATTGTCGCCCTAGCCGCCGGCTTCGTTGACGGCCGCGGCTGG
GGTGACAATGCAAAGGCTGCCATTATGCGTATCGGTCTCATGGAGATGGTCAAGTTTGGCAAGGAATTCTTTGGC
GAGACGGTTCAGAGCAGCACATTCACCGAGACATCGGCCGGTGTTGCCGACCTCATCACCTCGTGCTCTGGAGGA
CGAAATTTCCGCTGCGCCCGCAAGGCCGTCGACAAGGGCATCTCCGTGGATGAGGTCGAGAAGCAGGACCTTAAC
GGCCAGAAGTTGCAGGGCACGACGACGGCGTACGAGGTCAACAGCTTCCTTCAGAGGCGGGGACTCGAAAAAGAC
TATCCCCTCTTCACCGCTGTCAATGATATCTTGCGAGGCAAGAAGCAGGTCGACGATATTCCCCGGCTTGTCGCC
GTTGCCGACGGGGAGCAACAGTGA
Transcript >Ophcf2|03606
ATGTCTGCTCCTCAACTCCTCGGCGGACATGCCCGAAAGCACAAGGTCACCATCGTCGGCTCCGGCAACTGGGGC
TCGACCATTGCCAAGATCGTGGCCGAGAACACGCGTCTGCATCAGAAGGTCTTTGAGGAGACGGTTCAGATGTGG
GTGTTTGAGGAGGATGTCGTTATCCCCAAGACGTCCAAGCACTATGACGCGGCTGTCGGCGAGAGGCCCCAGAAG
CTCACGTCGGTCATCAACTCGATTCACGAGAACGTCAAGTATCTGCCTGACATCACGCTGCCAACTAACATCGTG
GCAAATCCATCCATCGTCGACGCCGTTCGCGACTCTACCATCCTCATCTTCAACCTGCCTCATCAGTTTATCGGC
AAGGTCTGCGAGCAGATCCGCGGCCACATTCTTCCCTACGCGCGCGGCATCAGCTGCATCAAGGGAGTCAACGTC
TCCGACGACGGCGTCAGCCTCTTCAGCGAGTGGATTGGTGACGGCTTGAACATTTACGTCGGCGCCCTCAGCGGT
GCCAACATCGCCAACGAGATCGCCGCAGAAAAATGGTCCGAGACCACCATCGCCTACGACCCGCCCCCTATGGAC
AGCCGCGCGCCCTCTCCGAGATCAGGCAGCCCCTTGCCCAGCCCGGGCCTTGTCATCACCGAGGCCCAGACTGAC
GGCCAGCACCTTCACCATCGCGACGCCCGAGGCCGCACCTCCAAGACGCGACTGACGCCCGTCCCCCCCCAATAT
CCGCCGTTGGAGCACGACTGCTTCCGTCTTCTCTTCCACCGGCCCTACTTTCACGTGCAGATGGTCTCGGACGTG
GCTGGCGTGTCGCTCGGAGGCGCCCTCAAGAACATTGTCGCCCTAGCCGCCGGCTTCGTTGACGGCCGCGGCTGG
GGTGACAATGCAAAGGCTGCCATTATGCGTATCGGTCTCATGGAGATGGTCAAGTTTGGCAAGGAATTCTTTGGC
GAGACGGTTCAGAGCAGCACATTCACCGAGACATCGGCCGGTGTTGCCGACCTCATCACCTCGTGCTCTGGAGGA
CGAAATTTCCGCTGCGCCCGCAAGGCCGTCGACAAGGGCATCTCCGTGGATGAGGTCGAGAAGCAGGACCTTAAC
GGCCAGAAGTTGCAGGGCACGACGACGGCGTACGAGGTCAACAGCTTCCTTCAGAGGCGGGGACTCGAAAAAGAC
TATCCCCTCTTCACCGCTGTCAATGATATCTTGCGAGGCAAGAAGCAGGTCGACGATATTCCCCGGCTTGTCGCC
GTTGCCGACGGGGAGCAACAGTGA
Gene >Ophcf2|03606
ATGTCTGCTCCTCAACTCCTCGGCGGACATGCCCGAAAGCACAAGGTCACCATCGTCGGCTCCGGCAACTGGGGC
TCGACCATTGCCAAGATCGTGGCCGAGAACACGCGTCTGCATCAGAAGGTCTTTGAGGAGACGGTTCAGATGTGG
GTGTTTGAGGAGGATGTCGTTATCCCCAAGACGTCCAAGCACTATGACGCGGCTGTCGGCGAGAGGCCCCAGAAG
CTCACGTCGGTCATCAACTCGATTCACGAGAACGTCAAGTATCTGCCTGACATCACGCTGCCAACTAACATCGTG
GCAAATCCATCCATCGTCGACGCCGTTCGCGACTCTACCATCCTCATCTTCAACCTGCCTCATCAGTTTATCGGC
AAGGTCTGCGAGCAGATCCGCGGCCACATTCTTCCCTACGCGCGCGGCATCAGCTGCATCAAGGGAGTCAACGTC
TCCGACGACGGCGTCAGCCTCTTCAGCGAGTGGATTGGTGACGGCTTGAACATTTACGTCGGCGCCCTCAGCGGT
GCCAACATCGCCAACGAGATCGCCGCAGAAAAATGGTCCGAGACCACCATCGCCTACGACCCGCCCCCTATGGAC
AGCCGCGCGCCCTCTCCGAGATCAGGCAGCCCCTTGCCCAGCCCGGGCCTTGTCATCACCGAGGCCCAGACTGAC
GGCCAGCACCTTCACCATCGCGACGCCCGAGGCCGCACCTCCAAGACGCGACTGACGCCCGTCCCCCCCCAATAT
CCGCCGTTGGAGCACGACTGCTTCCGTCTTCTCTTCCACCGGCCCTACTTTCACGTGCAGATGGTCTCGGACGTG
GCTGGCGTGTCGCTCGGAGGCGCCCTCAAGAACATTGTCGCCCTAGCCGCCGGCTTCGTTGACGGCCGCGGCTGG
GGTGACAATGCAAAGGCTGCCATTATGCGTATCGGTCTCATGGAGATGGTCAAGTTTGGCAAGGAATTCTTTGGC
GAGACGGTTCAGAGCAGCACATTCACCGAGACATCGGCCGGTGTTGCCGACCTCATCACCTCGTGCTCTGGAGGA
CGAAATTTCCGCTGCGCCCGCAAGGCCGTCGACAAGGGCATCTCCGTGGATGAGGTCGAGAAGCAGGACCTTAAC
GGCCAGAAGTTGCAGGGCACGACGACGGCGTACGAGGTCAACAGCTTCCTTCAGAGGCGGGGACTCGAAAAAGAC
TATCCCCTCTTCACCGCTGTCAATGATATCTTGCGAGGCAAGAAGCAGGTCGACGATATTCCCCGGCTTGTCGCC
GTTGCCGACGGGGAGCAACAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail