Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03591
Gene name
Locationscaffold_03:3211481..3214139
Strand-
Gene length (bp)2658
Transcript length (bp)2658
Coding sequence length (bp)2658
Protein length (aa) 886

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 3.7E-71 394 636
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 7.5E-07 660 728

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 526 543 17
2 550 572 22
3 582 604 22
4 617 639 22
5 654 676 22
6 790 812 22
7 854 876 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 68.62 37.98 99.26
Alive In ants, during behavior modification 26.90 14.82 38.98
Dead In ants, recently dead 34.11 19.49 48.72

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.157279 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03591
MAGGPTSSSRQASDVPTPSRKPKKRVGWHSSSNSGGGGVDSAGNDESASRSPLVSPGRPLLANPPGAPDARELVL
ALTKVLSDEREHENQEQQQWHQVPLISEPAPVVTTPPRAPRPALRRNTSYDGPEEREKADQAEQQATQRQLRSLT
DARQRADRLAISVVRDSAPGSRRTSNDLDATFQPLMGDADNVEPINVAAATPDSRLEAPPPLTPHPRRRNIASDD
HALAQTLVKSHTLRDKARDLFHRRPPAQEPHQDYVSRPPRYRGGILSSLLKLYNDDRGPGGGSNNSSGYTTPTLL
ATPLMSPRASPPPSRPASTAGGPRVRSGMGLFGTSTASLSELIKSSSMLAAPVTSDIHDQWTDKIRREKPQRSSR
KARARITVHIAGIISRHRYLLKLCRALMMYGAPTHRLEEYLTMSARVLEIEGQFLYIPSCMLVSFDDSTTHTTEV
KVVRVPQGIDLGKLRDVHNIYKDVVHDKLGVEEATRRLDEVMQRKPKFHTWLRVPVYGVASACVAPFAFEGRFID
LPIAFILGCIVGLLQLVFAPSNELYAHVFEVSAAVITSFLARGFGSLQQGNLFCFSALAQSSIALILPGYMVLCS
SLELQSHNIVAGSVRMVHAMIYTLFLGYGITIGASLYGMMDKNATSDTHCHNPLPRPWYFVFVPGFTLCLCILNQ
AKWRQTPTMTFMALAGFCVNSYCSIYFEQNTQISNMLGALTIGILANLYSRLGRHIHNYWLDMVEWWEYRMRPRF
GLRRRRQADFADNWSIPSLSDPESRPASPEKPQFRQPRKVGYSLAAAAMLPAIFVQVPSGLAAGGSLLAGVTSAN
ALNGNPEVLANASRMGGIDSTAFNVLFSVIQVAIGISVGLFMSALIVYPLGKRRSGLFSF*
Coding >Ophcf2|03591
ATGGCGGGAGGGCCAACCAGCAGCAGCAGACAGGCTAGCGACGTGCCGACGCCCAGTCGCAAACCAAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGCGGAGGGGTCGACAGCGCAGGGAATGACGAGAGCGCCTCCAGA
TCGCCGCTCGTCTCTCCGGGGCGTCCGCTGCTGGCCAACCCCCCCGGCGCCCCGGACGCGCGCGAACTGGTCCTG
GCCCTCACAAAGGTGCTCTCGGACGAACGAGAGCACGAAAATCAGGAGCAGCAGCAGTGGCATCAGGTCCCCCTC
ATCTCGGAGCCGGCCCCCGTCGTCACCACCCCTCCCAGGGCCCCGAGGCCGGCCCTGAGACGCAACACCAGCTAC
GATGGGCCGGAGGAACGCGAAAAGGCGGACCAGGCAGAGCAGCAAGCCACCCAGCGCCAGCTCCGCTCCCTGACT
GACGCACGCCAGCGTGCAGATCGGCTGGCCATATCCGTGGTCCGGGACTCTGCCCCGGGCTCCAGACGGACCTCG
AATGACTTGGACGCTACATTCCAGCCCTTGATGGGTGACGCAGATAATGTCGAGCCCATCAACGTCGCTGCTGCC
ACTCCCGACTCGAGGCTGGAGGCGCCGCCTCCTCTTACCCCCCACCCTCGTCGACGTAATATCGCTTCCGACGAC
CACGCCCTCGCCCAAACTCTCGTCAAGTCTCACACGCTGAGGGACAAGGCCCGCGACTTATTCCACCGCAGGCCG
CCCGCCCAGGAGCCTCATCAAGACTACGTCTCCCGCCCGCCACGATACCGCGGCGGCATCCTGTCTTCCCTGCTC
AAGCTCTACAACGATGATAGAGGCCCTGGCGGCGGCAGTAACAACAGCAGCGGCTACACGACGCCCACATTGCTC
GCAACGCCCCTCATGTCGCCCCGTGCGTCCCCGCCGCCGTCGCGCCCGGCCTCGACGGCGGGAGGCCCCCGAGTC
CGCAGCGGTATGGGCTTGTTCGGCACCTCGACGGCGTCGCTGTCGGAGCTCATCAAGTCGTCATCGATGCTGGCC
GCCCCCGTCACGAGTGATATCCACGACCAATGGACGGATAAGATCCGCCGCGAGAAGCCTCAGCGGTCGAGTCGA
AAGGCGAGGGCCCGCATCACCGTTCACATCGCCGGCATCATCTCCCGTCACCGATACCTGCTCAAGCTGTGTCGT
GCCCTCATGATGTACGGCGCCCCGACACACCGGCTAGAGGAATACCTCACCATGTCGGCTCGCGTGCTCGAGATC
GAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTCAGCTTCGACGACAGCACCACACACACGACCGAGGTC
AAGGTGGTTCGCGTGCCCCAGGGCATCGATCTGGGCAAGCTCCGTGACGTCCACAACATCTACAAAGACGTCGTC
CACGACAAGCTGGGCGTCGAGGAGGCGACTCGGCGTCTCGACGAGGTGATGCAGCGGAAGCCCAAGTTTCACACC
TGGCTCCGCGTGCCCGTCTATGGCGTGGCCTCGGCCTGCGTCGCGCCCTTTGCCTTTGAGGGCCGCTTCATAGAC
TTGCCCATCGCCTTTATCCTCGGCTGCATCGTCGGCCTGTTACAGCTCGTCTTTGCACCGAGCAACGAGCTGTAC
GCACACGTTTTCGAAGTCTCGGCCGCCGTCATCACCTCCTTCCTCGCCCGTGGCTTCGGCTCCCTGCAACAGGGC
AACCTCTTCTGCTTCAGCGCCCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCTGGCTACATGGTTCTGTGTAGC
TCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTACGGATGGTGCACGCCATGATCTACACACTCTTC
CTCGGATACGGCATCACCATCGGCGCATCGCTCTACGGCATGATGGACAAGAACGCGACGAGCGACACGCACTGC
CACAACCCCCTGCCGCGGCCCTGGTACTTCGTCTTCGTCCCGGGCTTCACCTTGTGTCTGTGCATCCTCAACCAG
GCCAAGTGGCGGCAGACGCCAACCATGACGTTTATGGCCCTCGCCGGATTCTGCGTCAACTCGTACTGCAGCATC
TACTTTGAGCAGAACACGCAAATCTCCAACATGCTGGGCGCCCTGACCATCGGCATCCTGGCTAATCTTTACTCG
AGACTGGGGCGTCACATTCACAACTACTGGCTGGACATGGTCGAATGGTGGGAGTACCGGATGCGGCCCCGGTTC
GGCCTGCGACGCCGCCGACAGGCCGACTTTGCCGACAACTGGTCCATCCCGTCACTGTCTGATCCCGAGTCCCGG
CCGGCGTCTCCGGAGAAGCCGCAGTTCCGCCAGCCTCGCAAGGTCGGATACAGTCTGGCGGCCGCCGCCATGCTG
CCAGCCATATTCGTCCAAGTGCCCTCGGGGCTGGCCGCCGGTGGCTCGCTGCTGGCGGGTGTCACGTCGGCCAAT
GCGCTCAACGGCAATCCCGAGGTGCTGGCCAACGCGTCGAGGATGGGCGGCATAGACAGCACCGCCTTTAATGTT
CTCTTCAGCGTCATCCAGGTCGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCCCTGATTGTGTATCCGCTG
GGCAAGAGGAGGAGCGGTCTGTTCAGTTTCTAG
Transcript >Ophcf2|03591
ATGGCGGGAGGGCCAACCAGCAGCAGCAGACAGGCTAGCGACGTGCCGACGCCCAGTCGCAAACCAAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGCGGAGGGGTCGACAGCGCAGGGAATGACGAGAGCGCCTCCAGA
TCGCCGCTCGTCTCTCCGGGGCGTCCGCTGCTGGCCAACCCCCCCGGCGCCCCGGACGCGCGCGAACTGGTCCTG
GCCCTCACAAAGGTGCTCTCGGACGAACGAGAGCACGAAAATCAGGAGCAGCAGCAGTGGCATCAGGTCCCCCTC
ATCTCGGAGCCGGCCCCCGTCGTCACCACCCCTCCCAGGGCCCCGAGGCCGGCCCTGAGACGCAACACCAGCTAC
GATGGGCCGGAGGAACGCGAAAAGGCGGACCAGGCAGAGCAGCAAGCCACCCAGCGCCAGCTCCGCTCCCTGACT
GACGCACGCCAGCGTGCAGATCGGCTGGCCATATCCGTGGTCCGGGACTCTGCCCCGGGCTCCAGACGGACCTCG
AATGACTTGGACGCTACATTCCAGCCCTTGATGGGTGACGCAGATAATGTCGAGCCCATCAACGTCGCTGCTGCC
ACTCCCGACTCGAGGCTGGAGGCGCCGCCTCCTCTTACCCCCCACCCTCGTCGACGTAATATCGCTTCCGACGAC
CACGCCCTCGCCCAAACTCTCGTCAAGTCTCACACGCTGAGGGACAAGGCCCGCGACTTATTCCACCGCAGGCCG
CCCGCCCAGGAGCCTCATCAAGACTACGTCTCCCGCCCGCCACGATACCGCGGCGGCATCCTGTCTTCCCTGCTC
AAGCTCTACAACGATGATAGAGGCCCTGGCGGCGGCAGTAACAACAGCAGCGGCTACACGACGCCCACATTGCTC
GCAACGCCCCTCATGTCGCCCCGTGCGTCCCCGCCGCCGTCGCGCCCGGCCTCGACGGCGGGAGGCCCCCGAGTC
CGCAGCGGTATGGGCTTGTTCGGCACCTCGACGGCGTCGCTGTCGGAGCTCATCAAGTCGTCATCGATGCTGGCC
GCCCCCGTCACGAGTGATATCCACGACCAATGGACGGATAAGATCCGCCGCGAGAAGCCTCAGCGGTCGAGTCGA
AAGGCGAGGGCCCGCATCACCGTTCACATCGCCGGCATCATCTCCCGTCACCGATACCTGCTCAAGCTGTGTCGT
GCCCTCATGATGTACGGCGCCCCGACACACCGGCTAGAGGAATACCTCACCATGTCGGCTCGCGTGCTCGAGATC
GAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTCAGCTTCGACGACAGCACCACACACACGACCGAGGTC
AAGGTGGTTCGCGTGCCCCAGGGCATCGATCTGGGCAAGCTCCGTGACGTCCACAACATCTACAAAGACGTCGTC
CACGACAAGCTGGGCGTCGAGGAGGCGACTCGGCGTCTCGACGAGGTGATGCAGCGGAAGCCCAAGTTTCACACC
TGGCTCCGCGTGCCCGTCTATGGCGTGGCCTCGGCCTGCGTCGCGCCCTTTGCCTTTGAGGGCCGCTTCATAGAC
TTGCCCATCGCCTTTATCCTCGGCTGCATCGTCGGCCTGTTACAGCTCGTCTTTGCACCGAGCAACGAGCTGTAC
GCACACGTTTTCGAAGTCTCGGCCGCCGTCATCACCTCCTTCCTCGCCCGTGGCTTCGGCTCCCTGCAACAGGGC
AACCTCTTCTGCTTCAGCGCCCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCTGGCTACATGGTTCTGTGTAGC
TCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTACGGATGGTGCACGCCATGATCTACACACTCTTC
CTCGGATACGGCATCACCATCGGCGCATCGCTCTACGGCATGATGGACAAGAACGCGACGAGCGACACGCACTGC
CACAACCCCCTGCCGCGGCCCTGGTACTTCGTCTTCGTCCCGGGCTTCACCTTGTGTCTGTGCATCCTCAACCAG
GCCAAGTGGCGGCAGACGCCAACCATGACGTTTATGGCCCTCGCCGGATTCTGCGTCAACTCGTACTGCAGCATC
TACTTTGAGCAGAACACGCAAATCTCCAACATGCTGGGCGCCCTGACCATCGGCATCCTGGCTAATCTTTACTCG
AGACTGGGGCGTCACATTCACAACTACTGGCTGGACATGGTCGAATGGTGGGAGTACCGGATGCGGCCCCGGTTC
GGCCTGCGACGCCGCCGACAGGCCGACTTTGCCGACAACTGGTCCATCCCGTCACTGTCTGATCCCGAGTCCCGG
CCGGCGTCTCCGGAGAAGCCGCAGTTCCGCCAGCCTCGCAAGGTCGGATACAGTCTGGCGGCCGCCGCCATGCTG
CCAGCCATATTCGTCCAAGTGCCCTCGGGGCTGGCCGCCGGTGGCTCGCTGCTGGCGGGTGTCACGTCGGCCAAT
GCGCTCAACGGCAATCCCGAGGTGCTGGCCAACGCGTCGAGGATGGGCGGCATAGACAGCACCGCCTTTAATGTT
CTCTTCAGCGTCATCCAGGTCGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCCCTGATTGTGTATCCGCTG
GGCAAGAGGAGGAGCGGTCTGTTCAGTTTCTAG
Gene >Ophcf2|03591
ATGGCGGGAGGGCCAACCAGCAGCAGCAGACAGGCTAGCGACGTGCCGACGCCCAGTCGCAAACCAAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGCGGAGGGGTCGACAGCGCAGGGAATGACGAGAGCGCCTCCAGA
TCGCCGCTCGTCTCTCCGGGGCGTCCGCTGCTGGCCAACCCCCCCGGCGCCCCGGACGCGCGCGAACTGGTCCTG
GCCCTCACAAAGGTGCTCTCGGACGAACGAGAGCACGAAAATCAGGAGCAGCAGCAGTGGCATCAGGTCCCCCTC
ATCTCGGAGCCGGCCCCCGTCGTCACCACCCCTCCCAGGGCCCCGAGGCCGGCCCTGAGACGCAACACCAGCTAC
GATGGGCCGGAGGAACGCGAAAAGGCGGACCAGGCAGAGCAGCAAGCCACCCAGCGCCAGCTCCGCTCCCTGACT
GACGCACGCCAGCGTGCAGATCGGCTGGCCATATCCGTGGTCCGGGACTCTGCCCCGGGCTCCAGACGGACCTCG
AATGACTTGGACGCTACATTCCAGCCCTTGATGGGTGACGCAGATAATGTCGAGCCCATCAACGTCGCTGCTGCC
ACTCCCGACTCGAGGCTGGAGGCGCCGCCTCCTCTTACCCCCCACCCTCGTCGACGTAATATCGCTTCCGACGAC
CACGCCCTCGCCCAAACTCTCGTCAAGTCTCACACGCTGAGGGACAAGGCCCGCGACTTATTCCACCGCAGGCCG
CCCGCCCAGGAGCCTCATCAAGACTACGTCTCCCGCCCGCCACGATACCGCGGCGGCATCCTGTCTTCCCTGCTC
AAGCTCTACAACGATGATAGAGGCCCTGGCGGCGGCAGTAACAACAGCAGCGGCTACACGACGCCCACATTGCTC
GCAACGCCCCTCATGTCGCCCCGTGCGTCCCCGCCGCCGTCGCGCCCGGCCTCGACGGCGGGAGGCCCCCGAGTC
CGCAGCGGTATGGGCTTGTTCGGCACCTCGACGGCGTCGCTGTCGGAGCTCATCAAGTCGTCATCGATGCTGGCC
GCCCCCGTCACGAGTGATATCCACGACCAATGGACGGATAAGATCCGCCGCGAGAAGCCTCAGCGGTCGAGTCGA
AAGGCGAGGGCCCGCATCACCGTTCACATCGCCGGCATCATCTCCCGTCACCGATACCTGCTCAAGCTGTGTCGT
GCCCTCATGATGTACGGCGCCCCGACACACCGGCTAGAGGAATACCTCACCATGTCGGCTCGCGTGCTCGAGATC
GAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTCAGCTTCGACGACAGCACCACACACACGACCGAGGTC
AAGGTGGTTCGCGTGCCCCAGGGCATCGATCTGGGCAAGCTCCGTGACGTCCACAACATCTACAAAGACGTCGTC
CACGACAAGCTGGGCGTCGAGGAGGCGACTCGGCGTCTCGACGAGGTGATGCAGCGGAAGCCCAAGTTTCACACC
TGGCTCCGCGTGCCCGTCTATGGCGTGGCCTCGGCCTGCGTCGCGCCCTTTGCCTTTGAGGGCCGCTTCATAGAC
TTGCCCATCGCCTTTATCCTCGGCTGCATCGTCGGCCTGTTACAGCTCGTCTTTGCACCGAGCAACGAGCTGTAC
GCACACGTTTTCGAAGTCTCGGCCGCCGTCATCACCTCCTTCCTCGCCCGTGGCTTCGGCTCCCTGCAACAGGGC
AACCTCTTCTGCTTCAGCGCCCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCTGGCTACATGGTTCTGTGTAGC
TCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTACGGATGGTGCACGCCATGATCTACACACTCTTC
CTCGGATACGGCATCACCATCGGCGCATCGCTCTACGGCATGATGGACAAGAACGCGACGAGCGACACGCACTGC
CACAACCCCCTGCCGCGGCCCTGGTACTTCGTCTTCGTCCCGGGCTTCACCTTGTGTCTGTGCATCCTCAACCAG
GCCAAGTGGCGGCAGACGCCAACCATGACGTTTATGGCCCTCGCCGGATTCTGCGTCAACTCGTACTGCAGCATC
TACTTTGAGCAGAACACGCAAATCTCCAACATGCTGGGCGCCCTGACCATCGGCATCCTGGCTAATCTTTACTCG
AGACTGGGGCGTCACATTCACAACTACTGGCTGGACATGGTCGAATGGTGGGAGTACCGGATGCGGCCCCGGTTC
GGCCTGCGACGCCGCCGACAGGCCGACTTTGCCGACAACTGGTCCATCCCGTCACTGTCTGATCCCGAGTCCCGG
CCGGCGTCTCCGGAGAAGCCGCAGTTCCGCCAGCCTCGCAAGGTCGGATACAGTCTGGCGGCCGCCGCCATGCTG
CCAGCCATATTCGTCCAAGTGCCCTCGGGGCTGGCCGCCGGTGGCTCGCTGCTGGCGGGTGTCACGTCGGCCAAT
GCGCTCAACGGCAATCCCGAGGTGCTGGCCAACGCGTCGAGGATGGGCGGCATAGACAGCACCGCCTTTAATGTT
CTCTTCAGCGTCATCCAGGTCGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCCCTGATTGTGTATCCGCTG
GGCAAGAGGAGGAGCGGTCTGTTCAGTTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail