Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03591
Gene name
Locationscaffold_03:3211481..3214139
Strand-
Gene length (bp)2658
Transcript length (bp)2658
Coding sequence length (bp)2658
Protein length (aa) 886

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 3.7E-71 394 636
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 7.5E-07 660 728

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 526 543 17
2 550 572 22
3 582 604 22
4 617 639 22
5 654 676 22
6 790 812 22
7 854 876 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03591
MAGGPTSSSRQASDVPTPSRKPKKRVGWHSSSNSGGGGVDSAGNDESASRSPLVSPGRPLLANPPGAPDARELVL
ALTKVLSDEREHENQEQQQWHQVPLISEPAPVVTTPPRAPRPALRRNTSYDGPEEREKADQAEQQATQRQLRSLT
DARQRADRLAISVVRDSAPGSRRTSNDLDATFQPLMGDADNVEPINVAAATPDSRLEAPPPLTPHPRRRNIASDD
HALAQTLVKSHTLRDKARDLFHRRPPAQEPHQDYVSRPPRYRGGILSSLLKLYNDDRGPGGGSNNSSGYTTPTLL
ATPLMSPRASPPPSRPASTAGGPRVRSGMGLFGTSTASLSELIKSSSMLAAPVTSDIHDQWTDKIRREKPQRSSR
KARARITVHIAGIISRHRYLLKLCRALMMYGAPTHRLEEYLTMSARVLEIEGQFLYIPSCMLVSFDDSTTHTTEV
KVVRVPQGIDLGKLRDVHNIYKDVVHDKLGVEEATRRLDEVMQRKPKFHTWLRVPVYGVASACVAPFAFEGRFID
LPIAFILGCIVGLLQLVFAPSNELYAHVFEVSAAVITSFLARGFGSLQQGNLFCFSALAQSSIALILPGYMVLCS
SLELQSHNIVAGSVRMVHAMIYTLFLGYGITIGASLYGMMDKNATSDTHCHNPLPRPWYFVFVPGFTLCLCILNQ
AKWRQTPTMTFMALAGFCVNSYCSIYFEQNTQISNMLGALTIGILANLYSRLGRHIHNYWLDMVEWWEYRMRPRF
GLRRRRQADFADNWSIPSLSDPESRPASPEKPQFRQPRKVGYSLAAAAMLPAIFVQVPSGLAAGGSLLAGVTSAN
ALNGNPEVLANASRMGGIDSTAFNVLFSVIQVAIGISVGLFMSALIVYPLGKRRSGLFSF*
Coding >Ophcf2|03591
ATGGCGGGAGGGCCAACCAGCAGCAGCAGACAGGCTAGCGACGTGCCGACGCCCAGTCGCAAACCAAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGCGGAGGGGTCGACAGCGCAGGGAATGACGAGAGCGCCTCCAGA
TCGCCGCTCGTCTCTCCGGGGCGTCCGCTGCTGGCCAACCCCCCCGGCGCCCCGGACGCGCGCGAACTGGTCCTG
GCCCTCACAAAGGTGCTCTCGGACGAACGAGAGCACGAAAATCAGGAGCAGCAGCAGTGGCATCAGGTCCCCCTC
ATCTCGGAGCCGGCCCCCGTCGTCACCACCCCTCCCAGGGCCCCGAGGCCGGCCCTGAGACGCAACACCAGCTAC
GATGGGCCGGAGGAACGCGAAAAGGCGGACCAGGCAGAGCAGCAAGCCACCCAGCGCCAGCTCCGCTCCCTGACT
GACGCACGCCAGCGTGCAGATCGGCTGGCCATATCCGTGGTCCGGGACTCTGCCCCGGGCTCCAGACGGACCTCG
AATGACTTGGACGCTACATTCCAGCCCTTGATGGGTGACGCAGATAATGTCGAGCCCATCAACGTCGCTGCTGCC
ACTCCCGACTCGAGGCTGGAGGCGCCGCCTCCTCTTACCCCCCACCCTCGTCGACGTAATATCGCTTCCGACGAC
CACGCCCTCGCCCAAACTCTCGTCAAGTCTCACACGCTGAGGGACAAGGCCCGCGACTTATTCCACCGCAGGCCG
CCCGCCCAGGAGCCTCATCAAGACTACGTCTCCCGCCCGCCACGATACCGCGGCGGCATCCTGTCTTCCCTGCTC
AAGCTCTACAACGATGATAGAGGCCCTGGCGGCGGCAGTAACAACAGCAGCGGCTACACGACGCCCACATTGCTC
GCAACGCCCCTCATGTCGCCCCGTGCGTCCCCGCCGCCGTCGCGCCCGGCCTCGACGGCGGGAGGCCCCCGAGTC
CGCAGCGGTATGGGCTTGTTCGGCACCTCGACGGCGTCGCTGTCGGAGCTCATCAAGTCGTCATCGATGCTGGCC
GCCCCCGTCACGAGTGATATCCACGACCAATGGACGGATAAGATCCGCCGCGAGAAGCCTCAGCGGTCGAGTCGA
AAGGCGAGGGCCCGCATCACCGTTCACATCGCCGGCATCATCTCCCGTCACCGATACCTGCTCAAGCTGTGTCGT
GCCCTCATGATGTACGGCGCCCCGACACACCGGCTAGAGGAATACCTCACCATGTCGGCTCGCGTGCTCGAGATC
GAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTCAGCTTCGACGACAGCACCACACACACGACCGAGGTC
AAGGTGGTTCGCGTGCCCCAGGGCATCGATCTGGGCAAGCTCCGTGACGTCCACAACATCTACAAAGACGTCGTC
CACGACAAGCTGGGCGTCGAGGAGGCGACTCGGCGTCTCGACGAGGTGATGCAGCGGAAGCCCAAGTTTCACACC
TGGCTCCGCGTGCCCGTCTATGGCGTGGCCTCGGCCTGCGTCGCGCCCTTTGCCTTTGAGGGCCGCTTCATAGAC
TTGCCCATCGCCTTTATCCTCGGCTGCATCGTCGGCCTGTTACAGCTCGTCTTTGCACCGAGCAACGAGCTGTAC
GCACACGTTTTCGAAGTCTCGGCCGCCGTCATCACCTCCTTCCTCGCCCGTGGCTTCGGCTCCCTGCAACAGGGC
AACCTCTTCTGCTTCAGCGCCCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCTGGCTACATGGTTCTGTGTAGC
TCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTACGGATGGTGCACGCCATGATCTACACACTCTTC
CTCGGATACGGCATCACCATCGGCGCATCGCTCTACGGCATGATGGACAAGAACGCGACGAGCGACACGCACTGC
CACAACCCCCTGCCGCGGCCCTGGTACTTCGTCTTCGTCCCGGGCTTCACCTTGTGTCTGTGCATCCTCAACCAG
GCCAAGTGGCGGCAGACGCCAACCATGACGTTTATGGCCCTCGCCGGATTCTGCGTCAACTCGTACTGCAGCATC
TACTTTGAGCAGAACACGCAAATCTCCAACATGCTGGGCGCCCTGACCATCGGCATCCTGGCTAATCTTTACTCG
AGACTGGGGCGTCACATTCACAACTACTGGCTGGACATGGTCGAATGGTGGGAGTACCGGATGCGGCCCCGGTTC
GGCCTGCGACGCCGCCGACAGGCCGACTTTGCCGACAACTGGTCCATCCCGTCACTGTCTGATCCCGAGTCCCGG
CCGGCGTCTCCGGAGAAGCCGCAGTTCCGCCAGCCTCGCAAGGTCGGATACAGTCTGGCGGCCGCCGCCATGCTG
CCAGCCATATTCGTCCAAGTGCCCTCGGGGCTGGCCGCCGGTGGCTCGCTGCTGGCGGGTGTCACGTCGGCCAAT
GCGCTCAACGGCAATCCCGAGGTGCTGGCCAACGCGTCGAGGATGGGCGGCATAGACAGCACCGCCTTTAATGTT
CTCTTCAGCGTCATCCAGGTCGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCCCTGATTGTGTATCCGCTG
GGCAAGAGGAGGAGCGGTCTGTTCAGTTTCTAG
Transcript >Ophcf2|03591
ATGGCGGGAGGGCCAACCAGCAGCAGCAGACAGGCTAGCGACGTGCCGACGCCCAGTCGCAAACCAAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGCGGAGGGGTCGACAGCGCAGGGAATGACGAGAGCGCCTCCAGA
TCGCCGCTCGTCTCTCCGGGGCGTCCGCTGCTGGCCAACCCCCCCGGCGCCCCGGACGCGCGCGAACTGGTCCTG
GCCCTCACAAAGGTGCTCTCGGACGAACGAGAGCACGAAAATCAGGAGCAGCAGCAGTGGCATCAGGTCCCCCTC
ATCTCGGAGCCGGCCCCCGTCGTCACCACCCCTCCCAGGGCCCCGAGGCCGGCCCTGAGACGCAACACCAGCTAC
GATGGGCCGGAGGAACGCGAAAAGGCGGACCAGGCAGAGCAGCAAGCCACCCAGCGCCAGCTCCGCTCCCTGACT
GACGCACGCCAGCGTGCAGATCGGCTGGCCATATCCGTGGTCCGGGACTCTGCCCCGGGCTCCAGACGGACCTCG
AATGACTTGGACGCTACATTCCAGCCCTTGATGGGTGACGCAGATAATGTCGAGCCCATCAACGTCGCTGCTGCC
ACTCCCGACTCGAGGCTGGAGGCGCCGCCTCCTCTTACCCCCCACCCTCGTCGACGTAATATCGCTTCCGACGAC
CACGCCCTCGCCCAAACTCTCGTCAAGTCTCACACGCTGAGGGACAAGGCCCGCGACTTATTCCACCGCAGGCCG
CCCGCCCAGGAGCCTCATCAAGACTACGTCTCCCGCCCGCCACGATACCGCGGCGGCATCCTGTCTTCCCTGCTC
AAGCTCTACAACGATGATAGAGGCCCTGGCGGCGGCAGTAACAACAGCAGCGGCTACACGACGCCCACATTGCTC
GCAACGCCCCTCATGTCGCCCCGTGCGTCCCCGCCGCCGTCGCGCCCGGCCTCGACGGCGGGAGGCCCCCGAGTC
CGCAGCGGTATGGGCTTGTTCGGCACCTCGACGGCGTCGCTGTCGGAGCTCATCAAGTCGTCATCGATGCTGGCC
GCCCCCGTCACGAGTGATATCCACGACCAATGGACGGATAAGATCCGCCGCGAGAAGCCTCAGCGGTCGAGTCGA
AAGGCGAGGGCCCGCATCACCGTTCACATCGCCGGCATCATCTCCCGTCACCGATACCTGCTCAAGCTGTGTCGT
GCCCTCATGATGTACGGCGCCCCGACACACCGGCTAGAGGAATACCTCACCATGTCGGCTCGCGTGCTCGAGATC
GAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTCAGCTTCGACGACAGCACCACACACACGACCGAGGTC
AAGGTGGTTCGCGTGCCCCAGGGCATCGATCTGGGCAAGCTCCGTGACGTCCACAACATCTACAAAGACGTCGTC
CACGACAAGCTGGGCGTCGAGGAGGCGACTCGGCGTCTCGACGAGGTGATGCAGCGGAAGCCCAAGTTTCACACC
TGGCTCCGCGTGCCCGTCTATGGCGTGGCCTCGGCCTGCGTCGCGCCCTTTGCCTTTGAGGGCCGCTTCATAGAC
TTGCCCATCGCCTTTATCCTCGGCTGCATCGTCGGCCTGTTACAGCTCGTCTTTGCACCGAGCAACGAGCTGTAC
GCACACGTTTTCGAAGTCTCGGCCGCCGTCATCACCTCCTTCCTCGCCCGTGGCTTCGGCTCCCTGCAACAGGGC
AACCTCTTCTGCTTCAGCGCCCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCTGGCTACATGGTTCTGTGTAGC
TCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTACGGATGGTGCACGCCATGATCTACACACTCTTC
CTCGGATACGGCATCACCATCGGCGCATCGCTCTACGGCATGATGGACAAGAACGCGACGAGCGACACGCACTGC
CACAACCCCCTGCCGCGGCCCTGGTACTTCGTCTTCGTCCCGGGCTTCACCTTGTGTCTGTGCATCCTCAACCAG
GCCAAGTGGCGGCAGACGCCAACCATGACGTTTATGGCCCTCGCCGGATTCTGCGTCAACTCGTACTGCAGCATC
TACTTTGAGCAGAACACGCAAATCTCCAACATGCTGGGCGCCCTGACCATCGGCATCCTGGCTAATCTTTACTCG
AGACTGGGGCGTCACATTCACAACTACTGGCTGGACATGGTCGAATGGTGGGAGTACCGGATGCGGCCCCGGTTC
GGCCTGCGACGCCGCCGACAGGCCGACTTTGCCGACAACTGGTCCATCCCGTCACTGTCTGATCCCGAGTCCCGG
CCGGCGTCTCCGGAGAAGCCGCAGTTCCGCCAGCCTCGCAAGGTCGGATACAGTCTGGCGGCCGCCGCCATGCTG
CCAGCCATATTCGTCCAAGTGCCCTCGGGGCTGGCCGCCGGTGGCTCGCTGCTGGCGGGTGTCACGTCGGCCAAT
GCGCTCAACGGCAATCCCGAGGTGCTGGCCAACGCGTCGAGGATGGGCGGCATAGACAGCACCGCCTTTAATGTT
CTCTTCAGCGTCATCCAGGTCGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCCCTGATTGTGTATCCGCTG
GGCAAGAGGAGGAGCGGTCTGTTCAGTTTCTAG
Gene >Ophcf2|03591
ATGGCGGGAGGGCCAACCAGCAGCAGCAGACAGGCTAGCGACGTGCCGACGCCCAGTCGCAAACCAAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGCGGAGGGGTCGACAGCGCAGGGAATGACGAGAGCGCCTCCAGA
TCGCCGCTCGTCTCTCCGGGGCGTCCGCTGCTGGCCAACCCCCCCGGCGCCCCGGACGCGCGCGAACTGGTCCTG
GCCCTCACAAAGGTGCTCTCGGACGAACGAGAGCACGAAAATCAGGAGCAGCAGCAGTGGCATCAGGTCCCCCTC
ATCTCGGAGCCGGCCCCCGTCGTCACCACCCCTCCCAGGGCCCCGAGGCCGGCCCTGAGACGCAACACCAGCTAC
GATGGGCCGGAGGAACGCGAAAAGGCGGACCAGGCAGAGCAGCAAGCCACCCAGCGCCAGCTCCGCTCCCTGACT
GACGCACGCCAGCGTGCAGATCGGCTGGCCATATCCGTGGTCCGGGACTCTGCCCCGGGCTCCAGACGGACCTCG
AATGACTTGGACGCTACATTCCAGCCCTTGATGGGTGACGCAGATAATGTCGAGCCCATCAACGTCGCTGCTGCC
ACTCCCGACTCGAGGCTGGAGGCGCCGCCTCCTCTTACCCCCCACCCTCGTCGACGTAATATCGCTTCCGACGAC
CACGCCCTCGCCCAAACTCTCGTCAAGTCTCACACGCTGAGGGACAAGGCCCGCGACTTATTCCACCGCAGGCCG
CCCGCCCAGGAGCCTCATCAAGACTACGTCTCCCGCCCGCCACGATACCGCGGCGGCATCCTGTCTTCCCTGCTC
AAGCTCTACAACGATGATAGAGGCCCTGGCGGCGGCAGTAACAACAGCAGCGGCTACACGACGCCCACATTGCTC
GCAACGCCCCTCATGTCGCCCCGTGCGTCCCCGCCGCCGTCGCGCCCGGCCTCGACGGCGGGAGGCCCCCGAGTC
CGCAGCGGTATGGGCTTGTTCGGCACCTCGACGGCGTCGCTGTCGGAGCTCATCAAGTCGTCATCGATGCTGGCC
GCCCCCGTCACGAGTGATATCCACGACCAATGGACGGATAAGATCCGCCGCGAGAAGCCTCAGCGGTCGAGTCGA
AAGGCGAGGGCCCGCATCACCGTTCACATCGCCGGCATCATCTCCCGTCACCGATACCTGCTCAAGCTGTGTCGT
GCCCTCATGATGTACGGCGCCCCGACACACCGGCTAGAGGAATACCTCACCATGTCGGCTCGCGTGCTCGAGATC
GAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTCAGCTTCGACGACAGCACCACACACACGACCGAGGTC
AAGGTGGTTCGCGTGCCCCAGGGCATCGATCTGGGCAAGCTCCGTGACGTCCACAACATCTACAAAGACGTCGTC
CACGACAAGCTGGGCGTCGAGGAGGCGACTCGGCGTCTCGACGAGGTGATGCAGCGGAAGCCCAAGTTTCACACC
TGGCTCCGCGTGCCCGTCTATGGCGTGGCCTCGGCCTGCGTCGCGCCCTTTGCCTTTGAGGGCCGCTTCATAGAC
TTGCCCATCGCCTTTATCCTCGGCTGCATCGTCGGCCTGTTACAGCTCGTCTTTGCACCGAGCAACGAGCTGTAC
GCACACGTTTTCGAAGTCTCGGCCGCCGTCATCACCTCCTTCCTCGCCCGTGGCTTCGGCTCCCTGCAACAGGGC
AACCTCTTCTGCTTCAGCGCCCTGGCCCAGAGCAGCATCGCCCTCATCCTGCCTGGCTACATGGTTCTGTGTAGC
TCGCTCGAGCTGCAGAGCCACAACATCGTGGCCGGCAGCGTACGGATGGTGCACGCCATGATCTACACACTCTTC
CTCGGATACGGCATCACCATCGGCGCATCGCTCTACGGCATGATGGACAAGAACGCGACGAGCGACACGCACTGC
CACAACCCCCTGCCGCGGCCCTGGTACTTCGTCTTCGTCCCGGGCTTCACCTTGTGTCTGTGCATCCTCAACCAG
GCCAAGTGGCGGCAGACGCCAACCATGACGTTTATGGCCCTCGCCGGATTCTGCGTCAACTCGTACTGCAGCATC
TACTTTGAGCAGAACACGCAAATCTCCAACATGCTGGGCGCCCTGACCATCGGCATCCTGGCTAATCTTTACTCG
AGACTGGGGCGTCACATTCACAACTACTGGCTGGACATGGTCGAATGGTGGGAGTACCGGATGCGGCCCCGGTTC
GGCCTGCGACGCCGCCGACAGGCCGACTTTGCCGACAACTGGTCCATCCCGTCACTGTCTGATCCCGAGTCCCGG
CCGGCGTCTCCGGAGAAGCCGCAGTTCCGCCAGCCTCGCAAGGTCGGATACAGTCTGGCGGCCGCCGCCATGCTG
CCAGCCATATTCGTCCAAGTGCCCTCGGGGCTGGCCGCCGGTGGCTCGCTGCTGGCGGGTGTCACGTCGGCCAAT
GCGCTCAACGGCAATCCCGAGGTGCTGGCCAACGCGTCGAGGATGGGCGGCATAGACAGCACCGCCTTTAATGTT
CTCTTCAGCGTCATCCAGGTCGCCATCGGCATCAGCGTCGGCCTGTTCATGAGCGCCCTGATTGTGTATCCGCTG
GGCAAGAGGAGGAGCGGTCTGTTCAGTTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail