Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03582
Gene name
Locationscaffold_03:3153460..3153763
Strand-
Gene length (bp)303
Transcript length (bp)303
Coding sequence length (bp)303
Protein length (aa) 101

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 4.9E-09 6 58
PF13637 Ank_4 Ankyrin repeats (many copies) 1.8E-05 38 89
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.7E-07 35 89
PF13606 Ank_3 Ankyrin repeat 2.5E-03 5 27
PF13606 Ank_3 Ankyrin repeat 3.3E-04 37 64
PF00023 Ank Ankyrin repeat 1.6E-02 6 29
PF00023 Ank Ankyrin repeat 4.4E-04 37 64

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6207 0.7343 0.2674 0.1628 0.1861 0.1591 0.0404 0.3345 0.1007 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup8173
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03582 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4011

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03582
MQDNEGRTALHEAADAGHYNMINSLVSKDVVARQDSYGRTALHWAVNNGHELAAKTLLEHMTADQVMIPDKLSQT
DLHRAAQFGFETIVSRIQETLPETT*
Coding >Ophcf2|03582
ATGCAAGACAACGAAGGACGGACGGCTCTACACGAAGCGGCAGACGCAGGTCACTACAATATGATAAACTCGCTG
GTCTCGAAAGATGTCGTTGCCAGACAGGATAGCTACGGTCGCACCGCGCTTCACTGGGCGGTGAACAATGGCCAC
GAACTGGCGGCGAAGACGCTTCTCGAGCACATGACGGCCGATCAAGTCATGATTCCGGACAAGTTGAGCCAGACG
GATTTGCACAGGGCTGCTCAATTCGGGTTCGAAACCATAGTGTCGAGGATCCAAGAGACGCTACCAGAGACGACT
TAA
Transcript >Ophcf2|03582
ATGCAAGACAACGAAGGACGGACGGCTCTACACGAAGCGGCAGACGCAGGTCACTACAATATGATAAACTCGCTG
GTCTCGAAAGATGTCGTTGCCAGACAGGATAGCTACGGTCGCACCGCGCTTCACTGGGCGGTGAACAATGGCCAC
GAACTGGCGGCGAAGACGCTTCTCGAGCACATGACGGCCGATCAAGTCATGATTCCGGACAAGTTGAGCCAGACG
GATTTGCACAGGGCTGCTCAATTCGGGTTCGAAACCATAGTGTCGAGGATCCAAGAGACGCTACCAGAGACGACT
TAA
Gene >Ophcf2|03582
ATGCAAGACAACGAAGGACGGACGGCTCTACACGAAGCGGCAGACGCAGGTCACTACAATATGATAAACTCGCTG
GTCTCGAAAGATGTCGTTGCCAGACAGGATAGCTACGGTCGCACCGCGCTTCACTGGGCGGTGAACAATGGCCAC
GAACTGGCGGCGAAGACGCTTCTCGAGCACATGACGGCCGATCAAGTCATGATTCCGGACAAGTTGAGCCAGACG
GATTTGCACAGGGCTGCTCAATTCGGGTTCGAAACCATAGTGTCGAGGATCCAAGAGACGCTACCAGAGACGACT
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail