Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03576
Gene name
Locationscaffold_03:3134272..3139373
Strand-
Gene length (bp)5101
Transcript length (bp)4959
Coding sequence length (bp)4959
Protein length (aa) 1653

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13001 Ecm29 Proteasome stabiliser 6.3E-136 14 509

GO

GO Term Description Terminal node
GO:0043248 proteasome assembly Yes
GO:0060090 molecular adaptor activity Yes
GO:0043933 protein-containing complex organization No
GO:0071840 cellular component organization or biogenesis No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0022607 cellular component assembly No
GO:0016043 cellular component organization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5912 0.7601 0.0262 0.103 0.1777 0.0221 0.1425 0.0847 0.0924 0.0082

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4505
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7030
Ophiocordyceps australis map64 (Brazil) OphauB2|1436
Ophiocordyceps camponoti-floridani Ophcf2|03576 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5466
Ophiocordyceps kimflemingae Ophio5|4541
Ophiocordyceps subramaniannii Hirsu2|9402

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03576
MAAPSTEQRELQLVDSVDFKILGVANKEEKLHQLLQRFLAPLLLKAASEHASVRTKVFQILGRLKTFVRPPSIVL
PVKELLKQYKSSQSPVVKQLDLSFANHSLDRLDAKDKMELIPIALEGLAAEGTLPSAACMLNIVLRLLLDLEIPP
RGSKEDSAFREAIGLSDSADAEYLANAIGIFFRLRTPREAQALTLSNPSLSQQELALFTTEKDESEKLFKRSSQL
KAKLVAFLASGAFTDKEKFLPALYAASGPDKRAASAAEEILKRSLVSLEDESLVQRLFRAHSVSPAAGRSRILGM
LSKSTVSTRMPDRILDVVEVDLDTDESAESWRRPTSVLEQTRLHTALFVYLSWVARIGPSRPPFTVGRPLIRYMQ
SYIEKQGWPLPLVDTHDAVYLRSKAYETLGSLARTADLIVTERLDVGDWLFQSLSEDFTNDAVVSIDGALSTMSA
SIPPSIGGTNASLKRLLLMHMTLPDGDPAVRSTRHAAVKWANQCLPFSDILGRWIDILATAARPDERSDVVEQGA
KGLDPWARSWSEEASPLPDWKDMVATFCDIGEDPNSRLFKRINEPSSDPTPSPYDSFCTKRRSIIGAALRYCRLI
LFLTALDGSDHYPTSIQVLERQVRQDIPTRLYIREYLKFNGTSVSLYLRSCLWNAKNSPSITEDCMDCFTDVASL
SPRDSLASLVDGGFSSLLLQLVESRNKKISTLAARAVGMLIAHPGFPAEDFDTWCFKLPLLITEATRRPAAEMDS
VEGGLMALSHLNSRAVYYDREFPKKTEYPFYLLVDEYLSSSLYETALYSFSELWTARLAMPPADSVEKIVGKLTA
QAKKGREKAVVALGRLSIGLEAAENTEVTDARGKSVETGTSVTILDTILDELFSLYDSGQAELQFSVGDAISCVA
ARWQSNTVAITMDVVPRNDRYFAPARSSVLEAVIGRLLRTCMDTKPSLLRSASIWLLCLIMNCSHLDPVQSRLRE
VQAAFMRLLAVKDEVVQETASRGLTLVYERGQGDLKASLVKDLVSAFTGSGTQLKVGEDTELFDPGALPTGEGKS
VTSYKDIVALANEAGDQRLVYKFMSLAADAATWSTRSAFGRFGLSSILSEADMDPKLYMKLYRYRFDPNPNVQRS
MDAIWKAVVKDPNATLDKHFGAIMEDLLKSQLGREWRVREASCAALSSLISGRPFAQYGKYYRDVWKTSLKVLDD
VKGSVREAARRLCMNLSNGVVRQLEEGNQSSVAKSMMREALPFLLSDKGMESTVKEVRIFATMTVLGICKKGGDA
LRPFIPEMMTQLLGLLSTIEPQEINYHYQRVGEDGRDEIDRLRSQMVNQSPISEAIDDMLRFVDADVMAELGPHL
EDTIKSAVGMPTKIGCSRVLTTLATRHTDLSPWASRFLKLLRKQVLDKNDEVSQAYARAAAYLWRKVSDKEQMEF
CEAFFNKYLAAEDERRRQKIADVILALAKISPDVFTANEVVILPFVYLGRHDTDEYTAKMFDEAWSQHAGSGRTV
MRYVTEIVALVEKCVEATQWSLRHTAAFTVAAMIRDVAKATDATGGISESMAGEMWPALCKTLALKTFPGKEKLL
ESFCQFVEQGRALWGVDEDVAMLMTQIAVREAKRNNDEYRVHAFRCLRRYSKARDDLDMSQQVEAITKPYEDKME
VD*
Coding >Ophcf2|03576
ATGGCTGCCCCTTCCACTGAGCAGCGAGAGCTGCAGCTGGTCGACAGCGTCGACTTCAAGATTCTGGGCGTCGCG
AACAAGGAAGAGAAGCTGCACCAACTTCTTCAGCGCTTTCTTGCCCCGCTTCTTCTCAAGGCTGCCAGTGAGCAT
GCTTCTGTACGGACAAAGGTTTTCCAAATACTGGGGAGACTTAAGACCTTCGTACGGCCCCCAAGCATCGTCTTG
CCTGTCAAGGAGCTGCTCAAGCAGTACAAGTCGAGTCAATCTCCAGTTGTCAAGCAACTGGATCTTTCTTTCGCC
AACCATAGTCTCGACAGATTAGACGCAAAAGATAAGATGGAGCTTATTCCTATCGCCCTGGAAGGACTCGCTGCT
GAAGGGACACTGCCGAGCGCTGCGTGTATGCTCAATATTGTCCTTCGGCTGCTTCTTGATCTTGAGATACCACCC
CGTGGAAGCAAGGAGGATTCCGCCTTCAGGGAGGCAATTGGTCTCTCGGATAGCGCGGATGCCGAGTATCTTGCC
AATGCAATCGGCATATTCTTCCGCTTGCGCACGCCAAGGGAAGCTCAGGCACTGACACTTTCGAATCCTTCCCTC
TCCCAACAAGAGCTGGCTCTGTTCACTACCGAAAAAGACGAAAGCGAGAAACTTTTCAAACGGTCATCACAGTTG
AAAGCAAAGCTGGTAGCCTTCCTGGCTAGCGGCGCCTTTACAGATAAGGAGAAGTTCTTGCCCGCTCTATACGCT
GCGTCTGGTCCAGACAAAAGAGCCGCCTCGGCTGCGGAGGAGATTCTCAAGAGAAGCTTGGTCTCACTGGAAGAC
GAATCACTGGTTCAACGCCTGTTCCGGGCGCACTCAGTTTCTCCGGCTGCCGGTCGCTCCCGCATACTGGGCATG
CTGAGCAAATCTACCGTGTCGACGAGGATGCCAGACAGAATACTTGACGTCGTTGAGGTTGACCTCGACACGGAC
GAGTCCGCTGAATCGTGGCGGCGTCCAACCAGCGTCCTGGAGCAGACTCGACTTCATACCGCCTTGTTCGTGTAC
CTGTCATGGGTCGCTCGAATCGGACCGTCGAGACCCCCGTTTACTGTTGGTCGGCCGCTCATCAGATACATGCAG
TCCTACATTGAAAAGCAGGGATGGCCTTTGCCTCTGGTCGACACTCACGATGCAGTCTATCTGCGGTCCAAGGCC
TACGAAACTCTCGGTTCACTGGCAAGAACCGCCGACCTCATCGTTACTGAGCGATTGGACGTCGGAGATTGGCTG
TTCCAGTCTCTTTCGGAAGACTTCACTAACGACGCAGTGGTCAGCATCGACGGGGCTCTCTCTACCATGTCGGCT
AGTATCCCACCGAGCATTGGTGGCACCAACGCGTCTCTGAAAAGATTGCTCTTGATGCACATGACTCTTCCCGAC
GGAGACCCTGCTGTCCGAAGCACGCGCCATGCTGCTGTCAAATGGGCAAATCAATGCCTGCCCTTCTCTGACATC
CTGGGCCGATGGATCGACATATTGGCAACGGCTGCGCGACCAGACGAACGCAGCGACGTGGTTGAACAGGGCGCC
AAAGGGCTGGATCCTTGGGCGAGATCATGGAGCGAGGAAGCCTCGCCTCTGCCCGACTGGAAGGATATGGTCGCA
ACTTTCTGCGATATTGGTGAAGATCCGAATAGCCGGCTATTTAAACGAATCAATGAGCCGTCGAGCGATCCCACT
CCTTCACCCTACGATAGCTTCTGCACAAAGCGACGGTCCATCATTGGCGCTGCGTTGCGATACTGCCGTCTCATT
CTGTTTCTGACGGCTCTCGACGGTTCGGATCACTACCCGACCAGCATTCAGGTTCTAGAAAGACAGGTCCGGCAA
GATATCCCCACCAGATTGTATATACGAGAGTACCTGAAGTTCAACGGCACCTCTGTCAGCCTCTACCTCAGGTCG
TGCTTGTGGAACGCCAAGAATTCTCCGTCCATCACGGAAGACTGCATGGACTGCTTCACGGATGTGGCTTCCCTC
AGTCCCAGGGACAGCCTGGCATCCTTGGTCGATGGCGGTTTCAGTTCGTTGTTGCTTCAACTCGTGGAATCCAGA
AACAAGAAGATCTCGACGTTGGCCGCGAGGGCCGTCGGCATGCTCATCGCTCATCCGGGCTTTCCAGCTGAGGAT
TTCGACACCTGGTGTTTCAAGCTGCCTCTGTTGATCACTGAAGCAACGAGGCGGCCAGCTGCAGAGATGGACTCT
GTCGAGGGCGGCTTGATGGCCCTCTCGCACCTCAACTCCCGCGCCGTCTACTACGACCGTGAATTTCCGAAGAAA
ACGGAGTATCCGTTCTATCTCTTGGTTGATGAATATTTATCCTCTTCGCTCTACGAGACTGCGCTGTATTCTTTC
TCGGAGCTCTGGACGGCAAGACTGGCTATGCCGCCAGCGGACTCTGTCGAAAAGATTGTCGGAAAACTCACGGCA
CAGGCGAAGAAAGGACGCGAAAAGGCGGTCGTTGCTCTTGGCCGCCTCTCCATAGGTCTCGAAGCTGCTGAGAAT
ACTGAGGTCACCGACGCTCGCGGGAAAAGCGTCGAGACTGGTACGTCGGTGACCATCCTAGACACCATTCTCGAC
GAGCTCTTTTCCCTATACGACTCGGGGCAGGCCGAGCTACAATTCTCCGTTGGAGATGCAATATCCTGCGTCGCA
GCCCGCTGGCAGTCAAACACAGTCGCAATAACCATGGACGTCGTTCCACGAAACGATCGTTACTTTGCTCCGGCG
AGAAGTTCCGTCCTAGAGGCCGTGATTGGTAGACTTCTCCGGACGTGCATGGACACGAAGCCATCCCTACTCAGA
TCGGCGAGCATCTGGCTGCTTTGTCTCATCATGAACTGCTCGCACCTGGACCCCGTTCAGTCTCGGCTGCGCGAG
GTACAGGCCGCCTTTATGCGCCTGCTGGCCGTGAAAGACGAGGTGGTGCAAGAGACGGCTTCCCGAGGTCTTACT
CTCGTCTACGAACGTGGCCAAGGCGACTTGAAGGCCTCCTTGGTTAAGGATCTGGTCTCAGCATTCACAGGATCG
GGAACCCAGCTCAAGGTGGGAGAAGACACTGAGCTGTTCGACCCTGGTGCTTTGCCCACAGGTGAAGGAAAGTCT
GTCACGTCATACAAAGACATTGTAGCGCTGGCCAACGAAGCTGGGGACCAAAGACTGGTTTACAAGTTCATGTCC
CTCGCGGCTGACGCGGCAACGTGGTCGACGCGATCGGCTTTTGGGCGGTTTGGACTCAGCAGCATACTGTCTGAG
GCAGACATGGATCCCAAGCTGTATATGAAGCTCTACAGGTACCGATTCGATCCCAATCCCAACGTGCAGAGGTCC
ATGGACGCCATCTGGAAGGCCGTGGTCAAGGATCCCAACGCAACACTGGACAAGCACTTTGGAGCCATCATGGAG
GACCTGCTCAAAAGTCAGCTGGGTCGCGAATGGAGGGTGAGGGAAGCCAGCTGTGCAGCACTATCGAGCCTGATA
TCCGGACGGCCGTTCGCTCAATACGGGAAGTACTACAGAGATGTTTGGAAAACATCGCTCAAGGTACTCGACGAC
GTCAAGGGAAGTGTACGCGAGGCGGCCCGGAGGCTCTGCATGAACCTATCAAACGGCGTCGTGCGGCAACTAGAG
GAGGGAAACCAATCGTCGGTGGCCAAGTCGATGATGCGGGAAGCTTTGCCTTTTCTCCTGTCGGACAAGGGCATG
GAGAGCACGGTAAAGGAGGTACGGATATTTGCCACGATGACTGTGCTGGGGATCTGCAAGAAAGGAGGCGATGCT
TTGCGCCCCTTTATACCCGAGATGATGACGCAGCTTCTCGGCCTGCTCAGCACCATCGAGCCCCAGGAGATCAAC
TATCATTACCAGCGAGTGGGAGAGGATGGGCGCGATGAAATCGACAGGCTACGGTCGCAGATGGTCAATCAGTCG
CCCATCTCCGAGGCAATCGACGACATGTTGCGCTTCGTCGACGCGGACGTCATGGCCGAACTAGGGCCTCATCTC
GAAGACACGATCAAGTCGGCGGTTGGAATGCCGACCAAGATTGGCTGCAGCAGAGTACTGACGACGCTGGCCACA
CGGCATACGGACCTGTCTCCATGGGCGAGCCGATTCCTCAAGCTGCTGAGGAAGCAGGTCTTGGACAAGAACGAC
GAGGTGAGCCAGGCATACGCTCGAGCGGCAGCCTACCTCTGGAGAAAGGTTTCGGACAAGGAGCAGATGGAGTTT
TGCGAGGCCTTTTTCAACAAGTATCTCGCAGCGGAAGATGAGCGTCGGCGCCAGAAGATTGCCGACGTCATCCTG
GCCCTAGCAAAGATCTCGCCCGACGTATTCACGGCTAACGAGGTGGTCATCTTGCCCTTTGTCTACCTCGGCCGC
CACGACACGGACGAATACACGGCCAAGATGTTTGACGAGGCATGGAGTCAGCACGCGGGGAGCGGCCGAACAGTG
ATGCGATACGTGACGGAGATTGTGGCCTTGGTCGAGAAGTGCGTGGAAGCGACGCAGTGGTCACTTCGACATACA
GCAGCCTTTACGGTGGCCGCCATGATCCGAGACGTTGCCAAGGCCACGGACGCAACTGGCGGAATAAGCGAGTCT
ATGGCCGGAGAAATGTGGCCGGCGCTGTGCAAGACGCTGGCTCTCAAGACTTTCCCCGGCAAGGAGAAGCTGCTG
GAATCCTTTTGCCAGTTTGTCGAGCAGGGTCGGGCGCTCTGGGGCGTCGACGAGGACGTTGCGATGCTGATGACA
CAGATTGCCGTCCGGGAAGCCAAGCGGAACAACGACGAGTACCGTGTTCACGCCTTTCGTTGTCTGAGGCGGTAT
TCGAAAGCACGAGACGATCTGGACATGTCGCAGCAGGTGGAGGCCATTACCAAGCCCTACGAGGACAAGATGGAG
GTTGACTGA
Transcript >Ophcf2|03576
ATGGCTGCCCCTTCCACTGAGCAGCGAGAGCTGCAGCTGGTCGACAGCGTCGACTTCAAGATTCTGGGCGTCGCG
AACAAGGAAGAGAAGCTGCACCAACTTCTTCAGCGCTTTCTTGCCCCGCTTCTTCTCAAGGCTGCCAGTGAGCAT
GCTTCTGTACGGACAAAGGTTTTCCAAATACTGGGGAGACTTAAGACCTTCGTACGGCCCCCAAGCATCGTCTTG
CCTGTCAAGGAGCTGCTCAAGCAGTACAAGTCGAGTCAATCTCCAGTTGTCAAGCAACTGGATCTTTCTTTCGCC
AACCATAGTCTCGACAGATTAGACGCAAAAGATAAGATGGAGCTTATTCCTATCGCCCTGGAAGGACTCGCTGCT
GAAGGGACACTGCCGAGCGCTGCGTGTATGCTCAATATTGTCCTTCGGCTGCTTCTTGATCTTGAGATACCACCC
CGTGGAAGCAAGGAGGATTCCGCCTTCAGGGAGGCAATTGGTCTCTCGGATAGCGCGGATGCCGAGTATCTTGCC
AATGCAATCGGCATATTCTTCCGCTTGCGCACGCCAAGGGAAGCTCAGGCACTGACACTTTCGAATCCTTCCCTC
TCCCAACAAGAGCTGGCTCTGTTCACTACCGAAAAAGACGAAAGCGAGAAACTTTTCAAACGGTCATCACAGTTG
AAAGCAAAGCTGGTAGCCTTCCTGGCTAGCGGCGCCTTTACAGATAAGGAGAAGTTCTTGCCCGCTCTATACGCT
GCGTCTGGTCCAGACAAAAGAGCCGCCTCGGCTGCGGAGGAGATTCTCAAGAGAAGCTTGGTCTCACTGGAAGAC
GAATCACTGGTTCAACGCCTGTTCCGGGCGCACTCAGTTTCTCCGGCTGCCGGTCGCTCCCGCATACTGGGCATG
CTGAGCAAATCTACCGTGTCGACGAGGATGCCAGACAGAATACTTGACGTCGTTGAGGTTGACCTCGACACGGAC
GAGTCCGCTGAATCGTGGCGGCGTCCAACCAGCGTCCTGGAGCAGACTCGACTTCATACCGCCTTGTTCGTGTAC
CTGTCATGGGTCGCTCGAATCGGACCGTCGAGACCCCCGTTTACTGTTGGTCGGCCGCTCATCAGATACATGCAG
TCCTACATTGAAAAGCAGGGATGGCCTTTGCCTCTGGTCGACACTCACGATGCAGTCTATCTGCGGTCCAAGGCC
TACGAAACTCTCGGTTCACTGGCAAGAACCGCCGACCTCATCGTTACTGAGCGATTGGACGTCGGAGATTGGCTG
TTCCAGTCTCTTTCGGAAGACTTCACTAACGACGCAGTGGTCAGCATCGACGGGGCTCTCTCTACCATGTCGGCT
AGTATCCCACCGAGCATTGGTGGCACCAACGCGTCTCTGAAAAGATTGCTCTTGATGCACATGACTCTTCCCGAC
GGAGACCCTGCTGTCCGAAGCACGCGCCATGCTGCTGTCAAATGGGCAAATCAATGCCTGCCCTTCTCTGACATC
CTGGGCCGATGGATCGACATATTGGCAACGGCTGCGCGACCAGACGAACGCAGCGACGTGGTTGAACAGGGCGCC
AAAGGGCTGGATCCTTGGGCGAGATCATGGAGCGAGGAAGCCTCGCCTCTGCCCGACTGGAAGGATATGGTCGCA
ACTTTCTGCGATATTGGTGAAGATCCGAATAGCCGGCTATTTAAACGAATCAATGAGCCGTCGAGCGATCCCACT
CCTTCACCCTACGATAGCTTCTGCACAAAGCGACGGTCCATCATTGGCGCTGCGTTGCGATACTGCCGTCTCATT
CTGTTTCTGACGGCTCTCGACGGTTCGGATCACTACCCGACCAGCATTCAGGTTCTAGAAAGACAGGTCCGGCAA
GATATCCCCACCAGATTGTATATACGAGAGTACCTGAAGTTCAACGGCACCTCTGTCAGCCTCTACCTCAGGTCG
TGCTTGTGGAACGCCAAGAATTCTCCGTCCATCACGGAAGACTGCATGGACTGCTTCACGGATGTGGCTTCCCTC
AGTCCCAGGGACAGCCTGGCATCCTTGGTCGATGGCGGTTTCAGTTCGTTGTTGCTTCAACTCGTGGAATCCAGA
AACAAGAAGATCTCGACGTTGGCCGCGAGGGCCGTCGGCATGCTCATCGCTCATCCGGGCTTTCCAGCTGAGGAT
TTCGACACCTGGTGTTTCAAGCTGCCTCTGTTGATCACTGAAGCAACGAGGCGGCCAGCTGCAGAGATGGACTCT
GTCGAGGGCGGCTTGATGGCCCTCTCGCACCTCAACTCCCGCGCCGTCTACTACGACCGTGAATTTCCGAAGAAA
ACGGAGTATCCGTTCTATCTCTTGGTTGATGAATATTTATCCTCTTCGCTCTACGAGACTGCGCTGTATTCTTTC
TCGGAGCTCTGGACGGCAAGACTGGCTATGCCGCCAGCGGACTCTGTCGAAAAGATTGTCGGAAAACTCACGGCA
CAGGCGAAGAAAGGACGCGAAAAGGCGGTCGTTGCTCTTGGCCGCCTCTCCATAGGTCTCGAAGCTGCTGAGAAT
ACTGAGGTCACCGACGCTCGCGGGAAAAGCGTCGAGACTGGTACGTCGGTGACCATCCTAGACACCATTCTCGAC
GAGCTCTTTTCCCTATACGACTCGGGGCAGGCCGAGCTACAATTCTCCGTTGGAGATGCAATATCCTGCGTCGCA
GCCCGCTGGCAGTCAAACACAGTCGCAATAACCATGGACGTCGTTCCACGAAACGATCGTTACTTTGCTCCGGCG
AGAAGTTCCGTCCTAGAGGCCGTGATTGGTAGACTTCTCCGGACGTGCATGGACACGAAGCCATCCCTACTCAGA
TCGGCGAGCATCTGGCTGCTTTGTCTCATCATGAACTGCTCGCACCTGGACCCCGTTCAGTCTCGGCTGCGCGAG
GTACAGGCCGCCTTTATGCGCCTGCTGGCCGTGAAAGACGAGGTGGTGCAAGAGACGGCTTCCCGAGGTCTTACT
CTCGTCTACGAACGTGGCCAAGGCGACTTGAAGGCCTCCTTGGTTAAGGATCTGGTCTCAGCATTCACAGGATCG
GGAACCCAGCTCAAGGTGGGAGAAGACACTGAGCTGTTCGACCCTGGTGCTTTGCCCACAGGTGAAGGAAAGTCT
GTCACGTCATACAAAGACATTGTAGCGCTGGCCAACGAAGCTGGGGACCAAAGACTGGTTTACAAGTTCATGTCC
CTCGCGGCTGACGCGGCAACGTGGTCGACGCGATCGGCTTTTGGGCGGTTTGGACTCAGCAGCATACTGTCTGAG
GCAGACATGGATCCCAAGCTGTATATGAAGCTCTACAGGTACCGATTCGATCCCAATCCCAACGTGCAGAGGTCC
ATGGACGCCATCTGGAAGGCCGTGGTCAAGGATCCCAACGCAACACTGGACAAGCACTTTGGAGCCATCATGGAG
GACCTGCTCAAAAGTCAGCTGGGTCGCGAATGGAGGGTGAGGGAAGCCAGCTGTGCAGCACTATCGAGCCTGATA
TCCGGACGGCCGTTCGCTCAATACGGGAAGTACTACAGAGATGTTTGGAAAACATCGCTCAAGGTACTCGACGAC
GTCAAGGGAAGTGTACGCGAGGCGGCCCGGAGGCTCTGCATGAACCTATCAAACGGCGTCGTGCGGCAACTAGAG
GAGGGAAACCAATCGTCGGTGGCCAAGTCGATGATGCGGGAAGCTTTGCCTTTTCTCCTGTCGGACAAGGGCATG
GAGAGCACGGTAAAGGAGGTACGGATATTTGCCACGATGACTGTGCTGGGGATCTGCAAGAAAGGAGGCGATGCT
TTGCGCCCCTTTATACCCGAGATGATGACGCAGCTTCTCGGCCTGCTCAGCACCATCGAGCCCCAGGAGATCAAC
TATCATTACCAGCGAGTGGGAGAGGATGGGCGCGATGAAATCGACAGGCTACGGTCGCAGATGGTCAATCAGTCG
CCCATCTCCGAGGCAATCGACGACATGTTGCGCTTCGTCGACGCGGACGTCATGGCCGAACTAGGGCCTCATCTC
GAAGACACGATCAAGTCGGCGGTTGGAATGCCGACCAAGATTGGCTGCAGCAGAGTACTGACGACGCTGGCCACA
CGGCATACGGACCTGTCTCCATGGGCGAGCCGATTCCTCAAGCTGCTGAGGAAGCAGGTCTTGGACAAGAACGAC
GAGGTGAGCCAGGCATACGCTCGAGCGGCAGCCTACCTCTGGAGAAAGGTTTCGGACAAGGAGCAGATGGAGTTT
TGCGAGGCCTTTTTCAACAAGTATCTCGCAGCGGAAGATGAGCGTCGGCGCCAGAAGATTGCCGACGTCATCCTG
GCCCTAGCAAAGATCTCGCCCGACGTATTCACGGCTAACGAGGTGGTCATCTTGCCCTTTGTCTACCTCGGCCGC
CACGACACGGACGAATACACGGCCAAGATGTTTGACGAGGCATGGAGTCAGCACGCGGGGAGCGGCCGAACAGTG
ATGCGATACGTGACGGAGATTGTGGCCTTGGTCGAGAAGTGCGTGGAAGCGACGCAGTGGTCACTTCGACATACA
GCAGCCTTTACGGTGGCCGCCATGATCCGAGACGTTGCCAAGGCCACGGACGCAACTGGCGGAATAAGCGAGTCT
ATGGCCGGAGAAATGTGGCCGGCGCTGTGCAAGACGCTGGCTCTCAAGACTTTCCCCGGCAAGGAGAAGCTGCTG
GAATCCTTTTGCCAGTTTGTCGAGCAGGGTCGGGCGCTCTGGGGCGTCGACGAGGACGTTGCGATGCTGATGACA
CAGATTGCCGTCCGGGAAGCCAAGCGGAACAACGACGAGTACCGTGTTCACGCCTTTCGTTGTCTGAGGCGGTAT
TCGAAAGCACGAGACGATCTGGACATGTCGCAGCAGGTGGAGGCCATTACCAAGCCCTACGAGGACAAGATGGAG
GTTGACTGA
Gene >Ophcf2|03576
ATGGCTGCCCCTTCCACTGAGCAGCGAGAGCTGCAGCTGGTCGACAGCGTCGACTTCAAGATTCTGGGCGTCGCG
AACAAGGAAGAGAAGCTGCACCAACTTCTTCAGCGCTTTCTTGCCCCGCTTCTTCTCAAGGCTGCCAGTGAGCAT
GCTTCTGTACGGACAAAGGTGCGTCGAAGACGGAGTTCACTCACTCTTCCGAAGGCGCCGTTGGCCTTGGGCATC
TGGCCCGAGGTGGGAGGACGAAGAGACTAGCCTTAGCCGCTCCCCGCTGCCTCTCGTTGACTTGCGTTGACGGTT
CCTGAATCAGGTTTTCCAAATACTGGGGAGACTTAAGACCTTCGTACGGCCCCCAAGCATCGTCTTGCCTGTCAA
GGAGCTGCTCAAGCAGTACAAGTCGAGTCAATCTCCAGTTGTCAAGCAACTGGATCTTTCTTTCGCCAACCATAG
TCTCGACAGATTAGACGCAAAAGATAAGATGGAGCTTATTCCTATCGCCCTGGAAGGACTCGCTGCTGAAGGGAC
ACTGCCGAGCGCTGCGTGTATGCTCAATATTGTCCTTCGGCTGCTTCTTGATCTTGAGATACCACCCCGTGGAAG
CAAGGAGGATTCCGCCTTCAGGGAGGCAATTGGTCTCTCGGATAGCGCGGATGCCGAGTATCTTGCCAATGCAAT
CGGCATATTCTTCCGCTTGCGCACGCCAAGGGAAGCTCAGGCACTGACACTTTCGAATCCTTCCCTCTCCCAACA
AGAGCTGGCTCTGTTCACTACCGAAAAAGACGAAAGCGAGAAACTTTTCAAACGGTCATCACAGTTGAAAGCAAA
GCTGGTAGCCTTCCTGGCTAGCGGCGCCTTTACAGATAAGGAGAAGTTCTTGCCCGCTCTATACGCTGCGTCTGG
TCCAGACAAAAGAGCCGCCTCGGCTGCGGAGGAGATTCTCAAGAGAAGCTTGGTCTCACTGGAAGACGAATCACT
GGTTCAACGCCTGTTCCGGGCGCACTCAGTTTCTCCGGCTGCCGGTCGCTCCCGCATACTGGGCATGCTGAGCAA
ATCTACCGTGTCGACGAGGATGCCAGACAGAATACTTGACGTCGTTGAGGTTGACCTCGACACGGACGAGTCCGC
TGAATCGTGGCGGCGTCCAACCAGCGTCCTGGAGCAGACTCGACTTCATACCGCCTTGTTCGTGTACCTGTCATG
GGTCGCTCGAATCGGACCGTCGAGACCCCCGTTTACTGTTGGTCGGCCGCTCATCAGATACATGCAGTCCTACAT
TGAAAAGCAGGGATGGCCTTTGCCTCTGGTCGACACTCACGATGCAGTCTATCTGCGGTCCAAGGCCTACGAAAC
TCTCGGTTCACTGGCAAGAACCGCCGACCTCATCGTTACTGAGCGATTGGACGTCGGAGATTGGCTGTTCCAGTC
TCTTTCGGAAGACTTCACTAACGACGCAGTGGTCAGCATCGACGGGGCTCTCTCTACCATGTCGGCTAGTATCCC
ACCGAGCATTGGTGGCACCAACGCGTCTCTGAAAAGATTGCTCTTGATGCACATGACTCTTCCCGACGGAGACCC
TGCTGTCCGAAGCACGCGCCATGCTGCTGTCAAATGGGCAAATCAATGCCTGCCCTTCTCTGACATCCTGGGCCG
ATGGATCGACATATTGGCAACGGCTGCGCGACCAGACGAACGCAGCGACGTGGTTGAACAGGGCGCCAAAGGGCT
GGATCCTTGGGCGAGATCATGGAGCGAGGAAGCCTCGCCTCTGCCCGACTGGAAGGATATGGTCGCAACTTTCTG
CGATATTGGTGAAGATCCGAATAGCCGGCTATTTAAACGAATCAATGAGCCGTCGAGCGATCCCACTCCTTCACC
CTACGATAGCTTCTGCACAAAGCGACGGTCCATCATTGGCGCTGCGTTGCGATACTGCCGTCTCATTCTGTTTCT
GACGGCTCTCGACGGTTCGGATCACTACCCGACCAGCATTCAGGTTCTAGAAAGACAGGTCCGGCAAGATATCCC
CACCAGATTGTATATACGAGAGTACCTGAAGTTCAACGGCACCTCTGTCAGCCTCTACCTCAGGTCGTGCTTGTG
GAACGCCAAGAATTCTCCGTCCATCACGGAAGACTGCATGGACTGCTTCACGGATGTGGCTTCCCTCAGTCCCAG
GGACAGCCTGGCATCCTTGGTCGATGGCGGTTTCAGTTCGTTGTTGCTTCAACTCGTGGAATCCAGAAACAAGAA
GATCTCGACGTTGGCCGCGAGGGCCGTCGGCATGCTCATCGCTCATCCGGGCTTTCCAGCTGAGGATTTCGACAC
CTGGTGTTTCAAGCTGCCTCTGTTGATCACTGAAGCAACGAGGCGGCCAGCTGCAGAGATGGACTCTGTCGAGGG
CGGCTTGATGGCCCTCTCGCACCTCAACTCCCGCGCCGTCTACTACGACCGTGAATTTCCGAAGAAAACGGAGTA
TCCGTTCTATCTCTTGGTTGATGAATATTTATCCTCTTCGCTCTACGAGACTGCGCTGTATTCTTTCTCGGAGCT
CTGGACGGCAAGACTGGCTATGCCGCCAGCGGACTCTGTCGAAAAGATTGTCGGAAAACTCACGGCACAGGCGAA
GAAAGGACGCGAAAAGGCGGTCGTTGCTCTTGGCCGCCTCTCCATAGGTCTCGAAGCTGCTGAGAATACTGAGGT
CACCGACGCTCGCGGGAAAAGCGTCGAGACTGGTACGTCGGTGACCATCCTAGACACCATTCTCGACGAGCTCTT
TTCCCTATACGACTCGGGGCAGGCCGAGCTACAATTCTCCGTTGGAGATGCAATATCCTGCGTCGCAGCCCGCTG
GCAGTCAAACACAGTCGCAATAACCATGGACGTCGTTCCACGAAACGATCGTTACTTTGCTCCGGCGAGAAGTTC
CGTCCTAGAGGCCGTGATTGGTAGACTTCTCCGGACGTGCATGGACACGAAGCCATCCCTACTCAGATCGGCGAG
CATCTGGCTGCTTTGTCTCATCATGAACTGCTCGCACCTGGACCCCGTTCAGTCTCGGCTGCGCGAGGTACAGGC
CGCCTTTATGCGCCTGCTGGCCGTGAAAGACGAGGTGGTGCAAGAGACGGCTTCCCGAGGTCTTACTCTCGTCTA
CGAACGTGGCCAAGGCGACTTGAAGGCCTCCTTGGTTAAGGATCTGGTCTCAGCATTCACAGGATCGGGAACCCA
GCTCAAGGTGGGAGAAGACACTGAGCTGTTCGACCCTGGTGCTTTGCCCACAGGTGAAGGAAAGTCTGTCACGTC
ATACAAAGACATTGTAGCGCTGGCCAACGAAGCTGGGGACCAAAGACTGGTTTACAAGTTCATGTCCCTCGCGGC
TGACGCGGCAACGTGGTCGACGCGATCGGCTTTTGGGCGGTTTGGACTCAGCAGCATACTGTCTGAGGCAGACAT
GGATCCCAAGCTGTATATGAAGCTCTACAGGTACCGATTCGATCCCAATCCCAACGTGCAGAGGTCCATGGACGC
CATCTGGAAGGCCGTGGTCAAGGATCCCAACGCAACACTGGACAAGCACTTTGGAGCCATCATGGAGGACCTGCT
CAAAAGTCAGCTGGGTCGCGAATGGAGGGTGAGGGAAGCCAGCTGTGCAGCACTATCGAGCCTGATATCCGGACG
GCCGTTCGCTCAATACGGGAAGTACTACAGAGATGTTTGGAAAACATCGCTCAAGGTACTCGACGACGTCAAGGG
AAGTGTACGCGAGGCGGCCCGGAGGCTCTGCATGAACCTATCAAACGGCGTCGTGCGGCAACTAGAGGAGGGAAA
CCAATCGTCGGTGGCCAAGTCGATGATGCGGGAAGCTTTGCCTTTTCTCCTGTCGGACAAGGGCATGGAGAGCAC
GGTAAAGGAGGTACGGATATTTGCCACGATGACTGTGCTGGGGATCTGCAAGAAAGGAGGCGATGCTTTGCGCCC
CTTTATACCCGAGATGATGACGCAGCTTCTCGGCCTGCTCAGCACCATCGAGCCCCAGGAGATCAACTATCATTA
CCAGCGAGTGGGAGAGGATGGGCGCGATGAAATCGACAGGCTACGGTCGCAGATGGTCAATCAGTCGCCCATCTC
CGAGGCAATCGACGACATGTTGCGCTTCGTCGACGCGGACGTCATGGCCGAACTAGGGCCTCATCTCGAAGACAC
GATCAAGTCGGCGGTTGGAATGCCGACCAAGATTGGCTGCAGCAGAGTACTGACGACGCTGGCCACACGGCATAC
GGACCTGTCTCCATGGGCGAGCCGATTCCTCAAGCTGCTGAGGAAGCAGGTCTTGGACAAGAACGACGAGGTGAG
CCAGGCATACGCTCGAGCGGCAGCCTACCTCTGGAGAAAGGTTTCGGACAAGGAGCAGATGGAGTTTTGCGAGGC
CTTTTTCAACAAGTATCTCGCAGCGGAAGATGAGCGTCGGCGCCAGAAGATTGCCGACGTCATCCTGGCCCTAGC
AAAGATCTCGCCCGACGTATTCACGGCTAACGAGGTGGTCATCTTGCCCTTTGTCTACCTCGGCCGCCACGACAC
GGACGAATACACGGCCAAGATGTTTGACGAGGCATGGAGTCAGCACGCGGGGAGCGGCCGAACAGTGATGCGATA
CGTGACGGAGATTGTGGCCTTGGTCGAGAAGTGCGTGGAAGCGACGCAGTGGTCACTTCGACATACAGCAGCCTT
TACGGTGGCCGCCATGATCCGAGACGTTGCCAAGGCCACGGACGCAACTGGCGGAATAAGCGAGTCTATGGCCGG
AGAAATGTGGCCGGCGCTGTGCAAGACGCTGGCTCTCAAGACTTTCCCCGGCAAGGAGAAGCTGCTGGAATCCTT
TTGCCAGTTTGTCGAGCAGGGTCGGGCGCTCTGGGGCGTCGACGAGGACGTTGCGATGCTGATGACACAGATTGC
CGTCCGGGAAGCCAAGCGGAACAACGACGAGTACCGTGTTCACGCCTTTCGTTGTCTGAGGCGGTATTCGAAAGC
ACGAGACGATCTGGACATGTCGCAGCAGGTGGAGGCCATTACCAAGCCCTACGAGGACAAGATGGAGGTTGACTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail