Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03574
Gene name
Locationscaffold_03:3129269..3130519
Strand+
Gene length (bp)1250
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 2.4E-80 42 369

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1477 0.0993 0.0371 0.0675 0.938 0.0554 0.0375 0.0246 0.0621 0.0077

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1077
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7033
Ophiocordyceps australis map64 (Brazil) OphauB2|1433
Ophiocordyceps camponoti-floridani Ophcf2|03574 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5990
Ophiocordyceps kimflemingae Ophio5|4538
Ophiocordyceps subramaniannii Hirsu2|10055

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03574
MLSRAPFRTAATQARRRMGSSRWMATVQSDIFQPAKYGGKYTVTLIPGDGIGAEVAESVKTVFKADNVPVEWEQV
AVSGLDAGGGRAEEAFRESVASLKRNKLGLKGILHTPISRSGHQSFNVAMRQELDMYASISLIKNIPGYSTRHRD
VDLCIIRENTEGEYSGLEHQSVPGVVESLKIITRAKSERIAKFACAFALANGRSKVTCIHKANIMKLADGLFRST
FHAVAKEYPTLEVNDMIVDNASMQAVSRPQQFDVMVMPNLYGGILSNIGAALVGGPGIVPGCNMGREIAVFEPGC
RHVGLDIKGKDQANPTAMILSGSMLLRHLGLDDHANRISRAIYAVIAEGKVRTRDMGGNSTTHEFTKAILDKMEA
D*
Coding >Ophcf2|03574
ATGCTGTCGAGAGCCCCCTTCCGGACGGCGGCGACGCAGGCCCGGCGACGGATGGGAAGCAGCCGTTGGATGGCG
ACGGTGCAGTCGGACATCTTCCAGCCGGCCAAGTACGGCGGTAAATACACGGTGACGCTGATCCCCGGTGACGGA
ATCGGCGCCGAGGTGGCCGAGTCTGTCAAGACGGTCTTCAAGGCGGATAACGTGCCGGTCGAGTGGGAGCAGGTG
GCTGTCTCGGGCCTGGACGCGGGAGGCGGACGGGCCGAGGAGGCCTTTCGCGAGAGCGTGGCATCGCTTAAGCGC
AATAAGCTGGGGCTCAAGGGTATTCTACACACGCCCATCAGTCGGTCGGGACATCAGAGCTTCAACGTTGCGATG
AGGCAGGAGCTCGACATGTATGCCAGCATCAGCCTCATCAAGAATATCCCTGGCTATTCTACGCGACACCGAGAC
GTCGACTTGTGCATCATCCGCGAGAATACAGAGGGCGAATACTCTGGACTCGAGCATCAGAGCGTACCGGGCGTC
GTCGAATCGCTCAAGATTATCACGCGGGCCAAGTCGGAGCGCATCGCAAAGTTCGCTTGTGCCTTTGCGCTGGCC
AACGGTCGGTCCAAGGTGACGTGCATCCACAAGGCCAACATCATGAAGCTGGCCGATGGGCTCTTCCGCAGCACC
TTTCACGCCGTCGCCAAGGAGTATCCCACTCTCGAGGTCAACGACATGATTGTCGATAACGCGTCCATGCAAGCC
GTGTCGCGGCCCCAGCAGTTTGACGTCATGGTCATGCCTAATCTGTACGGGGGCATCTTGTCGAATATCGGTGCT
GCTCTCGTCGGGGGCCCTGGAATTGTGCCCGGGTGCAATATGGGACGCGAAATTGCCGTCTTTGAGCCGGGTTGT
CGTCACGTTGGTCTTGATATCAAGGGCAAGGATCAGGCGAATCCCACAGCCATGATTCTGTCGGGGAGCATGCTG
CTGCGTCACTTGGGATTGGACGACCATGCGAATCGCATCTCGCGCGCCATCTACGCTGTCATTGCTGAGGGCAAG
GTGCGCACCCGCGACATGGGCGGCAATTCCACAACGCACGAGTTCACAAAGGCCATCCTCGACAAGATGGAAGCT
GACTGA
Transcript >Ophcf2|03574
ATGCTGTCGAGAGCCCCCTTCCGGACGGCGGCGACGCAGGCCCGGCGACGGATGGGAAGCAGCCGTTGGATGGCG
ACGGTGCAGTCGGACATCTTCCAGCCGGCCAAGTACGGCGGTAAATACACGGTGACGCTGATCCCCGGTGACGGA
ATCGGCGCCGAGGTGGCCGAGTCTGTCAAGACGGTCTTCAAGGCGGATAACGTGCCGGTCGAGTGGGAGCAGGTG
GCTGTCTCGGGCCTGGACGCGGGAGGCGGACGGGCCGAGGAGGCCTTTCGCGAGAGCGTGGCATCGCTTAAGCGC
AATAAGCTGGGGCTCAAGGGTATTCTACACACGCCCATCAGTCGGTCGGGACATCAGAGCTTCAACGTTGCGATG
AGGCAGGAGCTCGACATGTATGCCAGCATCAGCCTCATCAAGAATATCCCTGGCTATTCTACGCGACACCGAGAC
GTCGACTTGTGCATCATCCGCGAGAATACAGAGGGCGAATACTCTGGACTCGAGCATCAGAGCGTACCGGGCGTC
GTCGAATCGCTCAAGATTATCACGCGGGCCAAGTCGGAGCGCATCGCAAAGTTCGCTTGTGCCTTTGCGCTGGCC
AACGGTCGGTCCAAGGTGACGTGCATCCACAAGGCCAACATCATGAAGCTGGCCGATGGGCTCTTCCGCAGCACC
TTTCACGCCGTCGCCAAGGAGTATCCCACTCTCGAGGTCAACGACATGATTGTCGATAACGCGTCCATGCAAGCC
GTGTCGCGGCCCCAGCAGTTTGACGTCATGGTCATGCCTAATCTGTACGGGGGCATCTTGTCGAATATCGGTGCT
GCTCTCGTCGGGGGCCCTGGAATTGTGCCCGGGTGCAATATGGGACGCGAAATTGCCGTCTTTGAGCCGGGTTGT
CGTCACGTTGGTCTTGATATCAAGGGCAAGGATCAGGCGAATCCCACAGCCATGATTCTGTCGGGGAGCATGCTG
CTGCGTCACTTGGGATTGGACGACCATGCGAATCGCATCTCGCGCGCCATCTACGCTGTCATTGCTGAGGGCAAG
GTGCGCACCCGCGACATGGGCGGCAATTCCACAACGCACGAGTTCACAAAGGCCATCCTCGACAAGATGGAAGCT
GACTGA
Gene >Ophcf2|03574
ATGCTGTCGAGAGCCCCCTTCCGGACGGCGGCGACGCAGGTAGTGCACCTCTCATGCTCGGCGCCTCTTCCACAT
CCAACAGCTGACGAACAGCAACGCTACAGGCCCGGCGACGGATGGGAAGCAGCCGTTGGATGGCGACGGTGCAGT
CGGACATCTTCCAGCCGGCCAAGTACGGCGGTAAATACACGGTGACGCTGATCCCCGGTGACGGAATCGGCGCCG
AGGTGGCCGAGTCTGTCAAGACGGTCTTCAAGGCGGATAACGTGCCGGTCGAGTGGGAGCAGGTGGCTGTCTCGG
GCCTGGACGCGGGAGGCGGACGGGCCGAGGAGGCCTTTCGCGAGAGCGTGGCATCGCTTAAGCGCAATAAGCTGG
GGCTCAAGGGTATTCTACACACGCCCATCAGTCGGTCGGGACATCAGAGCTTCAACGTTGCGATGAGGCAGGAGC
TCGACATGTATGCCAGCATCAGCCTCATCAAGAATATCCCTGGCTATTCTACGCGACACCGAGACGTCGACTTGT
GCATCATCCGCGAGAATACAGAGGGCGAATACTCTGGACTCGAGCATCAGAGCGTACCGGGCGTCGTCGAATCGC
TCAAGATTATCACGCGGGCCAAGTCGGAGCGCATCGCAAAGTTCGCTTGTGCCTTTGCGCTGGCCAACGGTCGGT
CCAAGGTGACGTGCATCCACAAGGCCAACATCATGAAGCTGGCCGATGGGCTCTTCCGCAGCACCTTTCACGCCG
TCGCCAAGGAGTATCCCACTCTCGAGGTCAACGACATGATTGTCGATAACGCGTCCATGCAAGCCGTGTCGCGGC
CCCAGCAGTTTGACGTCATGGTCATGCCTAATCTGTACGGGGGCATCTTGTCGAATATCGGTGCTGCTCTCGTCG
GGGGCCCTGGAATTGTGCCCGGGTGCAATATGGGACGCGAAATTGCCGTCTTTGAGCCGGGTTGTCGTCACGTTG
GTCTTGATATCAAGGGCAAGGATCAGGCGAATCCCACAGCCATGATTCTGTCGGGGAGCATGCTGCTGCGTCACT
TGGGATTGGACGACCATGCGAATCGCATCTCGCGCGCCATCTACGCTGTCATTGCTGAGGGGTGAGACGTGATCT
GGATTCTTTCTTCCCTTCAAAGTGGGCTGACTTGAAGCAGCAAGGTGCGCACCCGCGACATGGGCGGCAATTCCA
CAACGCACGAGTTCACAAAGGCCATCCTCGACAAGATGGAAGCTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail