Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03571
Gene name
Locationscaffold_03:3122319..3123232
Strand+
Gene length (bp)913
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12589 WBS_methylT Methyltransferase involved in Williams-Beuren syndrome 1.4E-14 227 281
PF08241 Methyltransf_11 Methyltransferase domain 4.9E-11 52 161
PF13649 Methyltransf_25 Methyltransferase domain 3.4E-10 51 130
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 9.2E-05 29 90

GO

GO Term Description Terminal node
GO:0070476 rRNA (guanine-N7)-methylation Yes
GO:0008168 methyltransferase activity Yes
GO:0016435 rRNA (guanine) methyltransferase activity Yes
GO:0043414 macromolecule methylation No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0046483 heterocycle metabolic process No
GO:0032259 methylation No
GO:0140102 catalytic activity, acting on a rRNA No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0000154 rRNA modification No
GO:0008173 RNA methyltransferase activity No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0031167 rRNA methylation No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044237 cellular metabolic process No
GO:0016072 rRNA metabolic process No
GO:0036265 RNA (guanine-N7)-methylation No
GO:0001510 RNA methylation No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0009451 RNA modification No
GO:0008649 rRNA methyltransferase activity No
GO:0043412 macromolecule modification No
GO:0034470 ncRNA processing No
GO:0070475 rRNA base methylation No
GO:0006364 rRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5361 0.6417 0.0738 0.0225 0.1719 0.014 0.1131 0.0232 0.103 0.0014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1080
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5206
Ophiocordyceps australis map64 (Brazil) OphauB2|6828
Ophiocordyceps camponoti-floridani Ophcf2|03571 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5993
Ophiocordyceps kimflemingae Ophio5|4535
Ophiocordyceps subramaniannii Hirsu2|10059

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03571
MSRPEDSLAADVHYDDAEARKYTTSSRIQTIQATMTRRALQLLDLRRPSLILDVGCGSGLSGEILSAVAREEGGP
HAWIGLDLSPSMLDVALQRDVEGDLLLADMGQGVPFRAGTFDAAISISALQWLCSAESSDTSPAGRLARFFDGLY
ASLRRGGRAVCQFYPKNNAQRELVSRAAVKAGFGAGFLEDDPGTKNVKLYLVLTAGSAPADDDAQTGPSDITNVV
AGMDDVDIVDARAKAKAGNARVRKGSKAWIVKKKEQMERKGKIVKATSKYTGRKRRPAF*
Coding >Ophcf2|03571
ATGTCTCGTCCAGAGGATTCCCTCGCCGCCGACGTCCACTACGATGACGCCGAAGCCCGCAAATACACCACCAGC
TCGCGCATCCAAACCATCCAAGCAACCATGACGCGCCGCGCCCTACAACTCCTCGACCTGCGCCGACCATCGCTC
ATCCTAGACGTCGGTTGCGGAAGCGGTCTCTCCGGCGAGATTCTGTCAGCCGTGGCCCGCGAAGAGGGCGGCCCG
CACGCCTGGATAGGCCTCGACCTCTCGCCTTCGATGCTAGACGTAGCGCTGCAGAGGGACGTCGAGGGCGATTTG
CTCCTCGCTGATATGGGGCAGGGGGTTCCCTTTCGCGCTGGAACCTTTGACGCTGCTATTAGCATCTCTGCGCTG
CAGTGGCTTTGTAGCGCGGAGTCGTCGGACACGTCGCCCGCTGGCCGTCTCGCTCGCTTCTTCGACGGCCTCTAC
GCTTCGCTCCGCCGTGGCGGTCGCGCCGTCTGTCAGTTCTATCCCAAGAATAATGCCCAGCGTGAGCTAGTCTCT
CGCGCCGCCGTCAAGGCTGGTTTTGGCGCCGGCTTCCTCGAAGATGATCCGGGCACTAAGAACGTCAAGCTCTAC
CTCGTCCTCACCGCTGGCAGCGCCCCGGCCGATGATGACGCCCAGACTGGTCCCTCGGACATTACTAATGTCGTT
GCCGGCATGGACGATGTCGATATTGTAGACGCTCGCGCAAAGGCCAAGGCCGGCAACGCTCGCGTTCGCAAGGGA
AGCAAGGCCTGGATCGTCAAGAAAAAGGAGCAGATGGAGCGCAAGGGCAAGATTGTCAAGGCTACATCCAAGTAC
ACTGGCAGGAAACGTCGTCCGGCATTCTAG
Transcript >Ophcf2|03571
ATGTCTCGTCCAGAGGATTCCCTCGCCGCCGACGTCCACTACGATGACGCCGAAGCCCGCAAATACACCACCAGC
TCGCGCATCCAAACCATCCAAGCAACCATGACGCGCCGCGCCCTACAACTCCTCGACCTGCGCCGACCATCGCTC
ATCCTAGACGTCGGTTGCGGAAGCGGTCTCTCCGGCGAGATTCTGTCAGCCGTGGCCCGCGAAGAGGGCGGCCCG
CACGCCTGGATAGGCCTCGACCTCTCGCCTTCGATGCTAGACGTAGCGCTGCAGAGGGACGTCGAGGGCGATTTG
CTCCTCGCTGATATGGGGCAGGGGGTTCCCTTTCGCGCTGGAACCTTTGACGCTGCTATTAGCATCTCTGCGCTG
CAGTGGCTTTGTAGCGCGGAGTCGTCGGACACGTCGCCCGCTGGCCGTCTCGCTCGCTTCTTCGACGGCCTCTAC
GCTTCGCTCCGCCGTGGCGGTCGCGCCGTCTGTCAGTTCTATCCCAAGAATAATGCCCAGCGTGAGCTAGTCTCT
CGCGCCGCCGTCAAGGCTGGTTTTGGCGCCGGCTTCCTCGAAGATGATCCGGGCACTAAGAACGTCAAGCTCTAC
CTCGTCCTCACCGCTGGCAGCGCCCCGGCCGATGATGACGCCCAGACTGGTCCCTCGGACATTACTAATGTCGTT
GCCGGCATGGACGATGTCGATATTGTAGACGCTCGCGCAAAGGCCAAGGCCGGCAACGCTCGCGTTCGCAAGGGA
AGCAAGGCCTGGATCGTCAAGAAAAAGGAGCAGATGGAGCGCAAGGGCAAGATTGTCAAGGCTACATCCAAGTAC
ACTGGCAGGAAACGTCGTCCGGCATTCTAG
Gene >Ophcf2|03571
ATGTCTCGTCCAGAGGATTCCCTGTCCGTCTCAAACCTACAAATTGCTCTCTGACCCATGTAACGCTAACGCTCA
AGCCAGCGCCGCCGACGTCCACTACGATGACGCCGAAGCCCGCAAATACACCACCAGCTCGCGCATCCAAACCAT
CCAAGCAACCATGACGCGCCGCGCCCTACAACTCCTCGACCTGCGCCGACCATCGCTCATCCTAGACGTCGGTTG
CGGAAGCGGTCTCTCCGGCGAGATTCTGTCAGCCGTGGCCCGCGAAGAGGGCGGCCCGCACGCCTGGATAGGCCT
CGACCTCTCGCCTTCGATGCTAGACGTAGCGCTGCAGAGGGACGTCGAGGGCGATTTGCTCCTCGCTGATATGGG
GCAGGGGGTTCCCTTTCGCGCTGGAACCTTTGACGCTGCTATTAGCATCTCTGCGCTGCAGTGGCTTTGTAGCGC
GGAGTCGTCGGACACGTCGCCCGCTGGCCGTCTCGCTCGCTTCTTCGACGGCCTCTACGCTTCGCTCCGCCGTGG
CGGTCGCGCCGTCTGTCAGTTCTATCCCAAGAATAATGCCCAGCGTGAGCTAGTCTCTCGCGCCGCCGTCAAGGC
TGGTTTTGGCGCCGGCTTCCTCGAAGATGATCCGGGCACTAAGAACGTCAAGCTCTACCTCGTCCTCACCGCTGG
CAGCGCCCCGGCCGATGATGACGCCCAGACTGGTCCCTCGGACATTACTAATGTCGTTGCCGGCATGGACGATGT
CGATATTGTAGACGCTCGCGCAAAGGCCAAGGCCGGCAACGCTCGCGTTCGCAAGGGAAGCAAGGCCTGGATCGT
CAAGAAAAAGGAGCAGATGGAGCGCAAGGGCAAGATTGTCAAGGCTACATCCAAGTACACTGGCAGGAAACGTCG
TCCGGCATTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail