Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03570
Gene name
Locationscaffold_03:3120998..3122032
Strand-
Gene length (bp)1034
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04148 Erv26 Transmembrane adaptor Erv26 2.4E-88 1 195

GO

GO Term Description Terminal node
GO:0097020 COPII receptor activity Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0016021 integral component of membrane Yes
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0038024 cargo receptor activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0016192 vesicle-mediated transport No
GO:0046907 intracellular transport No
GO:0048193 Golgi vesicle transport No
GO:0051179 localization No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 31 21
2 44 61 17
3 65 82 17
4 89 111 22
5 137 159 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 209.47 120.34 298.59
Alive In ants, during behavior modification 188.51 107.98 269.04
Dead In ants, recently dead 182.10 104.50 259.70

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.618875 no
Alive Dead 0.866421 no
Dead Fungus 0.502306 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03570
MWILPLVGYAGTIVGFCFLTLAIASGLYYLSELVEEHTVIAKRLLTRLIYSIVGLQIVLWLVDGFPFWATVLGVV
AHVVYLANLRRFPFVQVTSPVFALAVVLVFLDHWVWFRHFSHGQTRAHQRSSYYDDVDAPTFTMIASYFGLCVWL
VPFALFVSLSAADNVLPTMGSEPVRGADGKSRHQGMVKAVVDRVRGAIGDLRMSMRPRDVKFHNHHEQPTFAVD*
Coding >Ophcf2|03570
ATGTGGATCCTGCCGCTTGTCGGCTACGCCGGGACTATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCGATCGTCGGCTTGCAGATTGTATTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACCGTGTTGGGCGTCGTT
GCTCATGTCGTCTATCTTGCCAATCTGAGGCGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGTTGGCA
GTCGTCCTTGTCTTCTTGGATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAGACGCGTGCCCATCAACGG
TCGTCGTACTATGACGACGTCGACGCCCCTACCTTTACCATGATCGCCTCTTACTTTGGCCTGTGTGTCTGGCTT
GTTCCTTTTGCCCTCTTCGTGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGT
GGCGCAGACGGCAAGAGCAGGCATCAGGGCATGGTCAAGGCTGTTGTCGATCGTGTTCGCGGCGCCATCGGGGAC
CTTCGAATGTCCATGAGGCCGAGAGACGTGAAATTCCACAATCACCATGAGCAGCCGACATTCGCCGTCGACTAG
Transcript >Ophcf2|03570
ATGTGGATCCTGCCGCTTGTCGGCTACGCCGGGACTATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCGATCGTCGGCTTGCAGATTGTATTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACCGTGTTGGGCGTCGTT
GCTCATGTCGTCTATCTTGCCAATCTGAGGCGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGTTGGCA
GTCGTCCTTGTCTTCTTGGATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAGACGCGTGCCCATCAACGG
TCGTCGTACTATGACGACGTCGACGCCCCTACCTTTACCATGATCGCCTCTTACTTTGGCCTGTGTGTCTGGCTT
GTTCCTTTTGCCCTCTTCGTGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGT
GGCGCAGACGGCAAGAGCAGGCATCAGGGCATGGTCAAGGCTGTTGTCGATCGTGTTCGCGGCGCCATCGGGGAC
CTTCGAATGTCCATGAGGCCGAGAGACGTGAAATTCCACAATCACCATGAGCAGCCGACATTCGCCGTCGACTAG
Gene >Ophcf2|03570
ATGTGGATCCTGCCGCTTGTCGGCTACGCCGGGACTATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCGATCGTCGGCTTGCAGATTGTATTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACCGTGTTGGGCGTCGTT
GCTCATGTCGTCTATCTTGCCAATCTGAGGCGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGTTGGCA
GTCGGTATGTCTGGTTCTTGACCGCTTCTCTTCCGTTGCTGACGACGCTGGATTCTGCAGTCCTTGTCTTCTTGG
ATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAGACGCGTGCCCATCAACGGTCGTCGTACTATGACGACG
TCGACGCCCCTACCTTTACCATGATCGCCTCTTACTTTGGCCTGTGTGTCTGGCTTGTTCCTTTTGCCCTCTTCG
TGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGTGGCGCAGACGGCAAGAGCA
GGCATCAGGGCATGGTCAAGGCTGTTGTCGATCGTGTTCGCGGCGCCATCGGGGACCTTGTCGGCTCTTGGAATA
TGGATCGGCCTTAGCCTTTGACGAGACACGGGTTCACCCTGTGGTCATGGGTTGTGTTGTGAAGGCTACCTCGAC
TCGCCTCTAGTTGAAGAGAAGTAACGCACGACCTAGCGAATGTGAGTCCTACTTTCATGTTTTTTTTTTCCGCCT
ATGATGAATTTCCATCACGCTAGATGGTATTTGACAAGGTAATGCCTTGTGTGATCATTTATGTCATAGTTACTC
TGACAGGCGTCACGTTTTATGGAGTCTACGATCATGTCATTAGTAGATGAGAGACTAACTGGGGCAGGTCCATGA
GGCCGAGAGACGTGAAATTCCACAATCACCATGAGCAGCCGACATTCGCCGTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail