Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03570
Gene name
Locationscaffold_03:3120998..3122032
Strand-
Gene length (bp)1034
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04148 Erv26 Transmembrane adaptor Erv26 2.4E-88 1 195

GO

GO Term Description Terminal node
GO:0097020 COPII receptor activity Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0016021 integral component of membrane Yes
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0038024 cargo receptor activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0016192 vesicle-mediated transport No
GO:0046907 intracellular transport No
GO:0048193 Golgi vesicle transport No
GO:0051179 localization No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 31 21
2 44 61 17
3 65 82 17
4 89 111 22
5 137 159 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03570
MWILPLVGYAGTIVGFCFLTLAIASGLYYLSELVEEHTVIAKRLLTRLIYSIVGLQIVLWLVDGFPFWATVLGVV
AHVVYLANLRRFPFVQVTSPVFALAVVLVFLDHWVWFRHFSHGQTRAHQRSSYYDDVDAPTFTMIASYFGLCVWL
VPFALFVSLSAADNVLPTMGSEPVRGADGKSRHQGMVKAVVDRVRGAIGDLRMSMRPRDVKFHNHHEQPTFAVD*
Coding >Ophcf2|03570
ATGTGGATCCTGCCGCTTGTCGGCTACGCCGGGACTATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCGATCGTCGGCTTGCAGATTGTATTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACCGTGTTGGGCGTCGTT
GCTCATGTCGTCTATCTTGCCAATCTGAGGCGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGTTGGCA
GTCGTCCTTGTCTTCTTGGATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAGACGCGTGCCCATCAACGG
TCGTCGTACTATGACGACGTCGACGCCCCTACCTTTACCATGATCGCCTCTTACTTTGGCCTGTGTGTCTGGCTT
GTTCCTTTTGCCCTCTTCGTGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGT
GGCGCAGACGGCAAGAGCAGGCATCAGGGCATGGTCAAGGCTGTTGTCGATCGTGTTCGCGGCGCCATCGGGGAC
CTTCGAATGTCCATGAGGCCGAGAGACGTGAAATTCCACAATCACCATGAGCAGCCGACATTCGCCGTCGACTAG
Transcript >Ophcf2|03570
ATGTGGATCCTGCCGCTTGTCGGCTACGCCGGGACTATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCGATCGTCGGCTTGCAGATTGTATTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACCGTGTTGGGCGTCGTT
GCTCATGTCGTCTATCTTGCCAATCTGAGGCGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGTTGGCA
GTCGTCCTTGTCTTCTTGGATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAGACGCGTGCCCATCAACGG
TCGTCGTACTATGACGACGTCGACGCCCCTACCTTTACCATGATCGCCTCTTACTTTGGCCTGTGTGTCTGGCTT
GTTCCTTTTGCCCTCTTCGTGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGT
GGCGCAGACGGCAAGAGCAGGCATCAGGGCATGGTCAAGGCTGTTGTCGATCGTGTTCGCGGCGCCATCGGGGAC
CTTCGAATGTCCATGAGGCCGAGAGACGTGAAATTCCACAATCACCATGAGCAGCCGACATTCGCCGTCGACTAG
Gene >Ophcf2|03570
ATGTGGATCCTGCCGCTTGTCGGCTACGCCGGGACTATTGTCGGCTTCTGCTTCCTGACGCTGGCCATTGCCTCT
GGGCTTTACTACCTGTCGGAGTTGGTTGAGGAGCACACAGTTATTGCGAAGCGGCTGCTGACGCGCCTGATTTAC
TCGATCGTCGGCTTGCAGATTGTATTGTGGCTTGTCGATGGGTTTCCCTTCTGGGCGACCGTGTTGGGCGTCGTT
GCTCATGTCGTCTATCTTGCCAATCTGAGGCGCTTCCCTTTCGTCCAGGTGACGAGTCCGGTCTTTGCGTTGGCA
GTCGGTATGTCTGGTTCTTGACCGCTTCTCTTCCGTTGCTGACGACGCTGGATTCTGCAGTCCTTGTCTTCTTGG
ATCACTGGGTGTGGTTCAGACATTTTTCACACGGCCAGACGCGTGCCCATCAACGGTCGTCGTACTATGACGACG
TCGACGCCCCTACCTTTACCATGATCGCCTCTTACTTTGGCCTGTGTGTCTGGCTTGTTCCTTTTGCCCTCTTCG
TGAGCTTGTCTGCCGCCGACAACGTCTTGCCCACCATGGGGTCGGAGCCGGTGCGTGGCGCAGACGGCAAGAGCA
GGCATCAGGGCATGGTCAAGGCTGTTGTCGATCGTGTTCGCGGCGCCATCGGGGACCTTGTCGGCTCTTGGAATA
TGGATCGGCCTTAGCCTTTGACGAGACACGGGTTCACCCTGTGGTCATGGGTTGTGTTGTGAAGGCTACCTCGAC
TCGCCTCTAGTTGAAGAGAAGTAACGCACGACCTAGCGAATGTGAGTCCTACTTTCATGTTTTTTTTTTCCGCCT
ATGATGAATTTCCATCACGCTAGATGGTATTTGACAAGGTAATGCCTTGTGTGATCATTTATGTCATAGTTACTC
TGACAGGCGTCACGTTTTATGGAGTCTACGATCATGTCATTAGTAGATGAGAGACTAACTGGGGCAGGTCCATGA
GGCCGAGAGACGTGAAATTCCACAATCACCATGAGCAGCCGACATTCGCCGTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail