Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03566
Gene name
Locationscaffold_03:3093516..3094748
Strand-
Gene length (bp)1232
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 1.2E-37 79 216

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0858 0.0415 0.9202 0.176 0.1556 0.0715 0.3841 0.2847 0.1727 0.0107

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.99965

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup409
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1744
Ophiocordyceps australis 1348a (Ghana) OphauG2|4903
Ophiocordyceps australis map64 (Brazil) OphauB2|1652
Ophiocordyceps australis map64 (Brazil) OphauB2|674
Ophiocordyceps camponoti-floridani Ophcf2|03566 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04883
Ophiocordyceps camponoti-rufipedis Ophun1|4103
Ophiocordyceps kimflemingae Ophio5|4527
Ophiocordyceps subramaniannii Hirsu2|2280

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03566
MLWNTSKLSLIFTLAAAALTAADKKPKDTLDRLKRYSLLCAISYLDDCPRPPSGITIAHRFDNNATGIIFKDANN
KEMVVAFRGTTNFRDIATDANFLVQSDFESPGISGCEGCKVHAGFLESWNTVAKDVISNLQGQLAENPDMKVVVT
GHSLGGAQASLAAMSIIGSGLDADVVTFGQPRTGNQAYADFVDEMAPDLIRVTHADDIVPQIPPKDLASSGYQHH
STEVWQEKDADAATTFQCEGQEPKDCNLSVKSQAKVPILGLPNVNLIGNISLGELASGSVAHGNYMGVPMGTFAD
GRSCGKAGNVLGQLTEGLTNILKGPSKPASKDN*
Coding >Ophcf2|03566
ATGTTGTGGAACACTTCCAAGTTGAGCCTCATCTTCACCCTCGCCGCCGCAGCACTCACGGCCGCAGATAAGAAA
CCCAAAGACACGCTCGACAGGTTGAAGCGCTACAGCCTCCTCTGCGCAATATCCTATCTAGACGACTGCCCCAGG
CCACCCAGCGGCATCACCATCGCACACAGATTCGACAACAACGCAACAGGCATCATCTTCAAAGATGCGAACAAC
AAGGAAATGGTCGTCGCCTTCCGCGGAACCACAAACTTCCGCGATATAGCCACCGACGCCAACTTCCTCGTCCAA
TCCGACTTTGAAAGCCCAGGCATCTCCGGCTGCGAGGGTTGCAAGGTCCACGCTGGATTCCTCGAATCTTGGAAT
ACCGTTGCCAAGGACGTCATCTCCAATCTTCAAGGTCAACTCGCCGAGAATCCGGATATGAAGGTCGTTGTGACG
GGCCATTCGCTTGGAGGTGCTCAGGCCTCGCTGGCTGCCATGTCCATCATTGGTTCGGGCCTGGATGCGGATGTC
GTTACCTTTGGACAGCCGCGGACGGGCAACCAGGCTTATGCCGACTTTGTGGATGAGATGGCGCCGGACTTGATT
CGCGTCACTCATGCCGATGATATCGTGCCGCAGATTCCGCCCAAGGATCTCGCCTCGTCTGGATACCAGCATCAC
TCTACCGAAGTATGGCAGGAGAAAGATGCGGACGCGGCCACGACGTTTCAGTGCGAGGGACAAGAGCCCAAGGAC
TGCAACCTCTCGGTCAAATCGCAAGCCAAAGTCCCCATCCTGGGCCTCCCCAACGTCAACCTCATCGGCAACATC
TCCCTCGGCGAACTCGCGTCAGGCAGTGTCGCACACGGAAACTACATGGGCGTCCCGATGGGCACCTTTGCCGAT
GGAAGGTCATGCGGCAAGGCGGGTAACGTGCTCGGCCAATTGACTGAGGGCCTCACCAACATCCTCAAGGGGCCG
AGTAAACCAGCCAGCAAAGACAACTGA
Transcript >Ophcf2|03566
ATGTTGTGGAACACTTCCAAGTTGAGCCTCATCTTCACCCTCGCCGCCGCAGCACTCACGGCCGCAGATAAGAAA
CCCAAAGACACGCTCGACAGGTTGAAGCGCTACAGCCTCCTCTGCGCAATATCCTATCTAGACGACTGCCCCAGG
CCACCCAGCGGCATCACCATCGCACACAGATTCGACAACAACGCAACAGGCATCATCTTCAAAGATGCGAACAAC
AAGGAAATGGTCGTCGCCTTCCGCGGAACCACAAACTTCCGCGATATAGCCACCGACGCCAACTTCCTCGTCCAA
TCCGACTTTGAAAGCCCAGGCATCTCCGGCTGCGAGGGTTGCAAGGTCCACGCTGGATTCCTCGAATCTTGGAAT
ACCGTTGCCAAGGACGTCATCTCCAATCTTCAAGGTCAACTCGCCGAGAATCCGGATATGAAGGTCGTTGTGACG
GGCCATTCGCTTGGAGGTGCTCAGGCCTCGCTGGCTGCCATGTCCATCATTGGTTCGGGCCTGGATGCGGATGTC
GTTACCTTTGGACAGCCGCGGACGGGCAACCAGGCTTATGCCGACTTTGTGGATGAGATGGCGCCGGACTTGATT
CGCGTCACTCATGCCGATGATATCGTGCCGCAGATTCCGCCCAAGGATCTCGCCTCGTCTGGATACCAGCATCAC
TCTACCGAAGTATGGCAGGAGAAAGATGCGGACGCGGCCACGACGTTTCAGTGCGAGGGACAAGAGCCCAAGGAC
TGCAACCTCTCGGTCAAATCGCAAGCCAAAGTCCCCATCCTGGGCCTCCCCAACGTCAACCTCATCGGCAACATC
TCCCTCGGCGAACTCGCGTCAGGCAGTGTCGCACACGGAAACTACATGGGCGTCCCGATGGGCACCTTTGCCGAT
GGAAGGTCATGCGGCAAGGCGGGTAACGTGCTCGGCCAATTGACTGAGGGCCTCACCAACATCCTCAAGGGGCCG
AGTAAACCAGCCAGCAAAGACAACTGA
Gene >Ophcf2|03566
ATGTTGTGGAACACTTCCAAGGTATGAAATCCTCAACTCACCTTACATCACCAGCTCACAGTCCACAAGTTGAGC
CTCATCTTCACCCTCGCCGCCGCAGCACTCACGGCCGCAGATAAGAAACCCAGTACGTCCCCTCAGACAGACAGC
ATTCGGCAACTAACCCGAGCACAGTTTCAGAAGACACGCTCGACAGGTTGAAGCGCTACAGCCTCCTCTGCGCAA
TATCCTATCTAGACGACTGCCCCAGGCCACCCAGCGGCATCACCATCGCACACAGATTCGACAACAACGCAACAG
GCATCATCTTCAAAGATGCGAACAACAAGGAAATGGTCGTCGCCTTCCGCGGAACCACAAACTTCCGCGATATAG
CCACCGACGCCAACTTCCTCGTCCAATCCGACTTTGAAAGCCCAGGCATCTCCGGCTGCGAGGGTTGCAAGGTAT
GAGACCCGTTCAGCCTAAAGAAAACCAGAAGCCAATCCATCCAGGTCCACGCTGGATTCCTCGAATCTTGGAATA
CCGTTGCCAAGGACGTCATCTCCAATCTTCAAGGTCAACTCGCCGAGAATCCGGATATGAAGGTCGTTGTGACGG
GCCATTCGCTTGGAGGTGCTCAGGCCTCGCTGGCTGCCATGTCCATCATTGGTTCGGGCCTGGATGCGGATGTCG
TTACCTTTGGACAGCCGCGGACGGGCAACCAGGCTTATGCCGACTTTGTGGATGAGATGGCGCCGGACTTGATTC
GCGTCACTCATGCCGATGATATCGTGCCGCAGATTCCGCCCAAGGATCTCGCCTCGTCTGGATACCAGCATCACT
CTACCGAAGTATGGCAGGAGAAAGATGCGGACGCGGCCACGACGTTTCAGTGCGAGGGACAAGAGCCCAAGGTAT
AACGCAGCATTGACACCATGCTTGCTGTCACCTCCCCTATTCCATTCCATTCAGAAGCTAAGCGTAACCAACATC
AGGACTGCAACCTCTCGGTCAAATCGCAAGCCAAAGTCCCCATCCTGGGCCTCCCCAACGTCAACCTCATCGGCA
ACATCTCCCTCGGCGAACTCGCGTCAGGCAGTGTCGCACACGGAAACTACATGGGCGTCCCGATGGGCACCTTTG
CCGATGGAAGGTCATGCGGCAAGGCGGGTAACGTGCTCGGCCAATTGACTGAGGGCCTCACCAACATCCTCAAGG
GGCCGAGTAAACCAGCCAGCAAAGACAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail