Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03561
Gene name
Locationscaffold_03:3082606..3084636
Strand-
Gene length (bp)2030
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.7E-32 55 269
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 4.7E-12 68 457
PF00083 Sugar_tr Sugar (and other) transporter 4.2E-11 84 218

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 81 103 22
3 115 137 22
4 142 164 22
5 177 199 22
6 204 226 22
7 247 266 19
8 276 298 22
9 324 346 22
10 361 378 17
11 391 413 22
12 423 445 22
13 466 483 17
14 528 547 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 36.36 20.16 52.57
Alive In ants, during behavior modification 13.02 5.83 20.21
Dead In ants, recently dead 20.21 9.99 30.43

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.024555 yes
Dead Fungus 0.003275 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03561
MPAPTVPHDVVELSNRSSKDADPPLIERRRISGDGEDTIVYIHGFRFWLLTIAISVMLFLASLDTTITTTSLVAI
THDLGGFQTASWILSGYQLGWVAVIVICAKLSDIFGRKPVFVVCITLFAVFSAGCAAAQTMAQLIVLRAFQGVGG
GGCLALTTILITEAVPPERLGAFASKINVALILSLVLGPVLGGAITSGTTWRWIFIINIPMSIMALALAHIGIPS
GFPHHDQSKSAQDPGASKVRKLARLDVVGSVLLIMAALSFTSGFQEADSRFAWNSAYVITLLVVSLLLWLVLLAW
ERHITLFSRVREPVIPWRFFTNRVRAGVMLVFVLVGVPIVVTNFQLPQRFQLVNGLSSIDASVRILPFGAAFCVG
SLASSRLTSSLRVPSIYHVLAGSAMQVVGFALLGVLRASPNIQPAVYGYQVLCGIGVGLNYMALYLLIPFTADRR
DRAIGMGLAGQFRTMGSAFGLAIVTSVFNGYTGPRLARLGLSAEVTSVEGLGTQRLSTITPEILADVRNILSEAY
NRQMLVLCAFAAAQMPAALLLWKRKQLVAA*
Coding >Ophcf2|03561
ATGCCGGCTCCTACAGTCCCCCACGATGTTGTCGAGCTCAGCAACCGTAGCTCGAAAGATGCTGATCCGCCTCTC
ATCGAGCGGCGCCGAATCAGCGGCGATGGTGAAGATACCATCGTCTATATCCATGGCTTTCGCTTCTGGCTCTTA
ACAATTGCCATCTCTGTCATGCTGTTCTTGGCCTCCCTTGACACAACCATCACAACTACATCCCTCGTTGCCATC
ACTCATGATCTGGGTGGTTTTCAGACCGCCAGTTGGATTCTCTCTGGCTACCAGCTGGGCTGGGTAGCTGTCATT
GTAATCTGCGCGAAGCTGAGCGATATCTTCGGACGCAAGCCAGTCTTCGTCGTCTGCATCACCCTTTTTGCCGTC
TTCTCTGCCGGCTGCGCAGCCGCTCAGACCATGGCTCAACTAATCGTTCTTCGTGCTTTTCAGGGTGTTGGTGGC
GGCGGCTGTCTGGCCCTGACGACCATCCTCATTACTGAGGCTGTGCCTCCGGAGAGGCTCGGCGCCTTTGCCTCC
AAGATCAACGTCGCCCTCATCTTGTCTCTCGTTCTGGGACCTGTTCTCGGCGGCGCCATTACCTCTGGTACAACG
TGGCGTTGGATCTTCATCATCAACATTCCCATGAGTATCATGGCCCTCGCGCTCGCCCACATCGGCATTCCGAGT
GGCTTTCCTCATCATGATCAGTCCAAGTCCGCCCAGGACCCGGGTGCGTCCAAGGTGAGGAAGCTAGCACGGTTG
GACGTCGTGGGCTCGGTGCTTCTGATCATGGCCGCGCTTTCTTTCACATCTGGCTTTCAGGAGGCCGATTCGCGG
TTTGCGTGGAACTCGGCCTACGTCATCACCCTTCTCGTCGTCTCCCTCCTCCTCTGGCTTGTTCTGCTGGCCTGG
GAGCGCCACATCACCTTGTTTAGCCGAGTTCGCGAACCCGTCATACCCTGGCGTTTCTTCACCAACCGCGTCAGG
GCCGGCGTCATGCTTGTCTTCGTTCTCGTGGGCGTGCCTATTGTCGTCACAAACTTCCAGCTGCCGCAGAGGTTT
CAGCTTGTCAATGGTCTCTCGAGCATCGACGCGAGCGTCCGAATTCTGCCTTTCGGCGCGGCCTTTTGCGTTGGT
TCCCTAGCCAGCTCGCGGCTCACCAGCAGTTTGAGGGTGCCCAGCATCTACCACGTGCTCGCCGGATCTGCCATG
CAGGTCGTCGGCTTTGCGCTTCTCGGCGTCTTGCGGGCTTCGCCAAATATCCAACCAGCAGTGTATGGTTACCAG
GTGCTTTGCGGCATCGGTGTTGGTCTCAACTACATGGCTCTGTATCTCCTGATCCCTTTTACCGCGGACCGAAGA
GACAGAGCCATTGGCATGGGCCTTGCCGGACAGTTCCGCACCATGGGGAGTGCCTTTGGACTGGCCATTGTCACG
TCCGTCTTTAACGGCTACACAGGTCCTCGATTAGCAAGGCTGGGCCTATCGGCTGAAGTCACCAGCGTCGAAGGT
TTGGGGACGCAGCGTCTGTCGACGATCACGCCCGAGATTTTAGCCGACGTGCGAAACATTCTGTCAGAGGCGTAC
AATCGGCAGATGCTGGTGCTGTGTGCTTTTGCAGCCGCCCAGATGCCAGCTGCACTGCTCCTGTGGAAGCGGAAA
CAACTTGTGGCAGCATAG
Transcript >Ophcf2|03561
ATGCCGGCTCCTACAGTCCCCCACGATGTTGTCGAGCTCAGCAACCGTAGCTCGAAAGATGCTGATCCGCCTCTC
ATCGAGCGGCGCCGAATCAGCGGCGATGGTGAAGATACCATCGTCTATATCCATGGCTTTCGCTTCTGGCTCTTA
ACAATTGCCATCTCTGTCATGCTGTTCTTGGCCTCCCTTGACACAACCATCACAACTACATCCCTCGTTGCCATC
ACTCATGATCTGGGTGGTTTTCAGACCGCCAGTTGGATTCTCTCTGGCTACCAGCTGGGCTGGGTAGCTGTCATT
GTAATCTGCGCGAAGCTGAGCGATATCTTCGGACGCAAGCCAGTCTTCGTCGTCTGCATCACCCTTTTTGCCGTC
TTCTCTGCCGGCTGCGCAGCCGCTCAGACCATGGCTCAACTAATCGTTCTTCGTGCTTTTCAGGGTGTTGGTGGC
GGCGGCTGTCTGGCCCTGACGACCATCCTCATTACTGAGGCTGTGCCTCCGGAGAGGCTCGGCGCCTTTGCCTCC
AAGATCAACGTCGCCCTCATCTTGTCTCTCGTTCTGGGACCTGTTCTCGGCGGCGCCATTACCTCTGGTACAACG
TGGCGTTGGATCTTCATCATCAACATTCCCATGAGTATCATGGCCCTCGCGCTCGCCCACATCGGCATTCCGAGT
GGCTTTCCTCATCATGATCAGTCCAAGTCCGCCCAGGACCCGGGTGCGTCCAAGGTGAGGAAGCTAGCACGGTTG
GACGTCGTGGGCTCGGTGCTTCTGATCATGGCCGCGCTTTCTTTCACATCTGGCTTTCAGGAGGCCGATTCGCGG
TTTGCGTGGAACTCGGCCTACGTCATCACCCTTCTCGTCGTCTCCCTCCTCCTCTGGCTTGTTCTGCTGGCCTGG
GAGCGCCACATCACCTTGTTTAGCCGAGTTCGCGAACCCGTCATACCCTGGCGTTTCTTCACCAACCGCGTCAGG
GCCGGCGTCATGCTTGTCTTCGTTCTCGTGGGCGTGCCTATTGTCGTCACAAACTTCCAGCTGCCGCAGAGGTTT
CAGCTTGTCAATGGTCTCTCGAGCATCGACGCGAGCGTCCGAATTCTGCCTTTCGGCGCGGCCTTTTGCGTTGGT
TCCCTAGCCAGCTCGCGGCTCACCAGCAGTTTGAGGGTGCCCAGCATCTACCACGTGCTCGCCGGATCTGCCATG
CAGGTCGTCGGCTTTGCGCTTCTCGGCGTCTTGCGGGCTTCGCCAAATATCCAACCAGCAGTGTATGGTTACCAG
GTGCTTTGCGGCATCGGTGTTGGTCTCAACTACATGGCTCTGTATCTCCTGATCCCTTTTACCGCGGACCGAAGA
GACAGAGCCATTGGCATGGGCCTTGCCGGACAGTTCCGCACCATGGGGAGTGCCTTTGGACTGGCCATTGTCACG
TCCGTCTTTAACGGCTACACAGGTCCTCGATTAGCAAGGCTGGGCCTATCGGCTGAAGTCACCAGCGTCGAAGGT
TTGGGGACGCAGCGTCTGTCGACGATCACGCCCGAGATTTTAGCCGACGTGCGAAACATTCTGTCAGAGGCGTAC
AATCGGCAGATGCTGGTGCTGTGTGCTTTTGCAGCCGCCCAGATGCCAGCTGCACTGCTCCTGTGGAAGCGGAAA
CAACTTGTGGCAGCATAG
Gene >Ophcf2|03561
ATGCCGGCTCCTACAGTCCCCCACGATGTTGTCGAGCTCAGCAACCGTAGCTCGAAAGATGCTGATCCGCCTCTC
ATCGAGCGGCGCCGAATCAGCGGCGATGGTGAAGATACCATCGTCTATATCCATGGCTTTCGCTTCTGGCTCTTA
ACAATTGCGTTCGTCTCGTCCGACTCTCTATCCGCTTAAGATGAGCTTCTCACCTGTCAACACTGCGCAGCATCT
CTGTCATGCTGTTCTTGGCCTCCCTTGACACAACCATCACAACTACATCCCTCGTTGCCATCACTCATGATCTGG
GTGGTTTTCAGACCGCCAGTTGGATTCTCTCTGGCTACCAGCTGGGCTGGGTAGGTGAGTCCACCGATTTGTCAC
GATGCTGCTGTCGGCCACCTCGCCCCCGATACTCATTGGTATGGTAGCTGTCATTGTAATCTGCGCGAAGCTGAG
CGATATCTTCGGACGCAAGCCAGTCTTCGTCGTCTGCATCACCCTTTTTGCCGTCTTCTCTGCCGGCTGCGCAGC
CGCTCAGACCATGGCTCAACTGTGAGTTTCTCACCTACGAGAACGACGCAGACTTTGTCTTAGCTGATGACCTAC
CCTCGGAAGAATCGTTCTTCGTGCTTTTCAGGGTGTTGGTGGCGGCGGCTGTCTGGCCCTGACGACCATCCTCAT
TACTGAGGCTGTGCCTCCGGAGAGGCTCGGCGCCTTTGCCTCCAAGATCAACGTCGCCCTCATCTTGTCTCTCGT
TCTGGGACCTGTTCTCGGCGGCGCCATTACCTCTGGTACAACGTGGCGTTGGATCTTCATCATCAAGTAACTATC
TCCGCCCGTCTCTAGTACATCGAATGAAGCTGATTAACGCCGGCCTGCTCAGCATTCCCATGAGTATCATGGCCC
TCGCGCTCGCCCACATCGGCATTCCGAGTGGCTTTCCTCATCATGATCAGTCCAAGTCCGCCCAGGACCCGGGTG
CGTCCAAGGTGAGGAAGCTAGCACGGTTGGACGTCGTGGGCTCGGTGCTTCTGATCATGGCCGCGCTTTCTTTCA
CATCTGGCTTTCAGGAGGCCGATTCGCGGTTTGCGTGGAACTCGGCCTACGTCATCACCCTTCTCGTCGTCTCCC
TCCTCCTCTGGCTTGTTCTGCTGGCCTGGGAGCGCCACATCACCTTGTTTAGCCGAGTTCGCGAACCCGTCATAC
CCTGGCGTTTCTTCACCAACCGCGTCAGGGCCGGCGTCATGCTGTGAGCAACCTGAGATCCCCGCGAAGCTCAAG
CGGCTGACATGGCACCTCAGTGTCTTCGTTCTCGTGGGCGTGCCTATTGTCGTCACAAACTTCCAGCTGCCGCAG
AGGTTTCAGCTTGTCAATGGTCTCTCGAGCATCGACGCGAGCGTCCGAATTCTGCCTTTCGGCGCGGCCTTTTGC
GTTGGTTCCCTAGCCAGCTCGCGGCTCACCAGCAGTTTGAGGGTGCCCAGCATCTACCACGTGCTCGCCGGATCT
GCCATGCAGGTCGTCGGCTTTGCGCTTCTCGGCGTCTTGCGGGCTTCGCCAAATATCCAACCAGCAGTGTATGGT
TACCAGGTGCTTTGCGGCATCGGTGTTGGTCTCAACTACATGGCTCTGTATCTCCTGATCCCTTTTACCGCGGAC
CGAAGAGACAGAGGTGAGTTGCGGAGATGTGCTCAATCGCAAAGAACGATTATACTGACGAGAAGACAGCCATTG
GCATGGGCCTTGCCGGACAGTTCCGCACCATGGGGAGTGCCTTTGGACTGGCCATTGTCACGTCCGTCTTTAACG
GCTACACAGGTCCTCGATTAGCAAGGCTGGGCCTATCGGCTGAAGTCACCAGCGTCGAAGGTTTGGGGACGCAGC
GTCTGTCGACGATCACGCCCGAGATTTTAGCCGACGTGCGAAACATTCTGTCAGAGGCGTACAATCGGCAGATGC
TGGTGCTGTGTGCTTTTGCAGCCGCCCAGATGCCAGCTGCACTGCTCCTGTGGAAGCGGAAACAACTTGTGGCAG
CATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail