Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03553
Gene name
Locationscaffold_03:3058527..3060297
Strand+
Gene length (bp)1770
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1338 0.1018 0.9292 0.127 0.1037 0.0103 0.1556 0.1815 0.1701 0.0009

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999709

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3817
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1896
Ophiocordyceps australis map64 (Brazil) OphauB2|2011
Ophiocordyceps camponoti-floridani Ophcf2|03553 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3613
Ophiocordyceps kimflemingae Ophio5|3284
Ophiocordyceps subramaniannii Hirsu2|7488

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03553
MYRLTFAAGALVAMHGVLAQQSPVTDQYPAEHTEEFKGYEGQYVDACSPVGTIRYNSTFPPCLSSSRIESSCALP
WKEGVSDEQRQGDWQAERKCLCEGSFFRDAGDGCLECKKAYHIDSEENVEVWKTVWKKIGDGYCEEKTLAGNFST
YWSGALAEIQGSFKYDKDLGAKPAPGSIPVEAYYTNDKQGPGPLPGSAPATPGNSSVPSNSTGEAGVAQLTPDCR
TMTGAIDTLPASNSAKFSNSSTGAILVSVTVNYNRICIINGPQRDIQAVPQSEPEVKPISEKVISKKEAAKEADF
DMTGCPCAQKAVPEGKEVVKSESSLNAWAKVSVICGFDKESRKGPEGCEGPDCGGASKGDEAPSPVPGDVYGADS
VMGTFGESEASKGSDSAEKPSTKNTVYVVKVNKESSGSETVGTYGQHKCTTCGKSKAPEGPFTGETENTYGQDQP
ETPDESQPDQTYGQQEGPSNEQPPATSPEQPKCEACENNKGPYGSEPETPSTEPQVPVPQEPKPDDTYAPTEGSS
SQQPQAPTEAQPQCPGGAACGGTDGTYGQPQCTDGSCDKPEIPSDSRKAPEPAGEDEEDDVNYC*
Coding >Ophcf2|03553
ATGTACAGACTCACCTTTGCAGCCGGTGCCCTCGTGGCCATGCACGGCGTCCTCGCCCAGCAATCACCCGTAACG
GACCAATACCCAGCCGAACACACGGAAGAATTCAAGGGTTACGAGGGCCAATACGTCGACGCCTGCTCTCCCGTC
GGCACCATCCGCTACAACTCGACTTTCCCCCCCTGCCTGAGCTCCAGCAGGATCGAGTCCAGCTGCGCGCTGCCC
TGGAAGGAGGGCGTTTCGGATGAGCAGCGTCAGGGAGACTGGCAGGCGGAGAGGAAGTGTCTCTGCGAGGGCAGC
TTCTTTCGCGATGCGGGCGATGGATGCCTCGAGTGCAAGAAGGCGTACCACATTGACAGCGAGGAAAACGTCGAG
GTTTGGAAGACAGTCTGGAAGAAGATTGGTGACGGCTACTGCGAGGAGAAGACTCTGGCGGGTAACTTCTCGACC
TACTGGTCCGGAGCCCTCGCCGAGATCCAGGGCTCTTTCAAGTATGACAAAGACCTCGGCGCCAAGCCCGCTCCC
GGAAGCATCCCCGTCGAAGCCTACTACACCAACGACAAGCAAGGACCGGGACCCCTCCCCGGCTCGGCCCCGGCC
ACACCCGGCAACAGCTCCGTACCGTCCAACTCTACGGGAGAGGCCGGCGTCGCCCAGCTGACTCCCGACTGCCGA
ACCATGACGGGCGCCATCGACACCCTCCCCGCCAGCAACAGCGCCAAGTTCTCCAACTCCAGCACCGGCGCCATC
CTCGTGTCCGTCACCGTCAACTACAACCGCATCTGCATCATCAACGGTCCCCAGCGTGATATCCAGGCCGTTCCC
CAGTCTGAGCCCGAGGTTAAGCCCATCTCCGAGAAGGTGATTTCCAAGAAGGAGGCTGCCAAGGAGGCCGACTTC
GACATGACTGGCTGCCCTTGCGCTCAGAAGGCTGTCCCCGAGGGTAAGGAGGTTGTCAAGTCGGAGTCTTCGCTC
AACGCCTGGGCCAAGGTCTCTGTCATCTGCGGCTTCGACAAGGAGAGTCGAAAGGGTCCCGAGGGATGTGAGGGT
CCCGATTGCGGCGGTGCCAGCAAGGGTGACGAGGCGCCCTCGCCTGTTCCTGGCGATGTCTACGGCGCCGACTCC
GTCATGGGAACCTTTGGCGAATCCGAGGCCTCCAAGGGCTCTGACTCGGCCGAGAAGCCTTCCACCAAGAACACG
GTCTACGTCGTAAAGGTCAACAAGGAATCCTCCGGCAGTGAGACCGTGGGCACTTATGGTCAGCACAAGTGCACC
ACCTGCGGAAAGTCCAAGGCCCCCGAAGGACCCTTCACCGGCGAGACGGAGAACACCTACGGTCAGGACCAGCCC
GAGACCCCGGATGAGTCCCAGCCTGATCAGACCTACGGACAGCAAGAGGGCCCTTCAAACGAGCAGCCCCCGGCC
ACGTCCCCGGAACAGCCCAAGTGCGAAGCCTGCGAGAACAACAAGGGCCCGTACGGCTCCGAGCCCGAGACCCCC
TCCACCGAGCCCCAGGTCCCCGTCCCGCAGGAGCCGAAGCCCGACGATACCTACGCACCGACGGAGGGCTCTTCC
AGCCAGCAGCCCCAGGCCCCTACCGAGGCGCAGCCCCAGTGCCCCGGCGGAGCCGCCTGCGGAGGAACCGACGGA
ACTTACGGCCAGCCGCAGTGCACTGACGGCTCCTGCGACAAGCCCGAGATCCCGTCTGACAGCCGGAAGGCTCCG
GAGCCGGCCGGGGAGGACGAGGAGGATGATGTCAACTACTGCTAG
Transcript >Ophcf2|03553
ATGTACAGACTCACCTTTGCAGCCGGTGCCCTCGTGGCCATGCACGGCGTCCTCGCCCAGCAATCACCCGTAACG
GACCAATACCCAGCCGAACACACGGAAGAATTCAAGGGTTACGAGGGCCAATACGTCGACGCCTGCTCTCCCGTC
GGCACCATCCGCTACAACTCGACTTTCCCCCCCTGCCTGAGCTCCAGCAGGATCGAGTCCAGCTGCGCGCTGCCC
TGGAAGGAGGGCGTTTCGGATGAGCAGCGTCAGGGAGACTGGCAGGCGGAGAGGAAGTGTCTCTGCGAGGGCAGC
TTCTTTCGCGATGCGGGCGATGGATGCCTCGAGTGCAAGAAGGCGTACCACATTGACAGCGAGGAAAACGTCGAG
GTTTGGAAGACAGTCTGGAAGAAGATTGGTGACGGCTACTGCGAGGAGAAGACTCTGGCGGGTAACTTCTCGACC
TACTGGTCCGGAGCCCTCGCCGAGATCCAGGGCTCTTTCAAGTATGACAAAGACCTCGGCGCCAAGCCCGCTCCC
GGAAGCATCCCCGTCGAAGCCTACTACACCAACGACAAGCAAGGACCGGGACCCCTCCCCGGCTCGGCCCCGGCC
ACACCCGGCAACAGCTCCGTACCGTCCAACTCTACGGGAGAGGCCGGCGTCGCCCAGCTGACTCCCGACTGCCGA
ACCATGACGGGCGCCATCGACACCCTCCCCGCCAGCAACAGCGCCAAGTTCTCCAACTCCAGCACCGGCGCCATC
CTCGTGTCCGTCACCGTCAACTACAACCGCATCTGCATCATCAACGGTCCCCAGCGTGATATCCAGGCCGTTCCC
CAGTCTGAGCCCGAGGTTAAGCCCATCTCCGAGAAGGTGATTTCCAAGAAGGAGGCTGCCAAGGAGGCCGACTTC
GACATGACTGGCTGCCCTTGCGCTCAGAAGGCTGTCCCCGAGGGTAAGGAGGTTGTCAAGTCGGAGTCTTCGCTC
AACGCCTGGGCCAAGGTCTCTGTCATCTGCGGCTTCGACAAGGAGAGTCGAAAGGGTCCCGAGGGATGTGAGGGT
CCCGATTGCGGCGGTGCCAGCAAGGGTGACGAGGCGCCCTCGCCTGTTCCTGGCGATGTCTACGGCGCCGACTCC
GTCATGGGAACCTTTGGCGAATCCGAGGCCTCCAAGGGCTCTGACTCGGCCGAGAAGCCTTCCACCAAGAACACG
GTCTACGTCGTAAAGGTCAACAAGGAATCCTCCGGCAGTGAGACCGTGGGCACTTATGGTCAGCACAAGTGCACC
ACCTGCGGAAAGTCCAAGGCCCCCGAAGGACCCTTCACCGGCGAGACGGAGAACACCTACGGTCAGGACCAGCCC
GAGACCCCGGATGAGTCCCAGCCTGATCAGACCTACGGACAGCAAGAGGGCCCTTCAAACGAGCAGCCCCCGGCC
ACGTCCCCGGAACAGCCCAAGTGCGAAGCCTGCGAGAACAACAAGGGCCCGTACGGCTCCGAGCCCGAGACCCCC
TCCACCGAGCCCCAGGTCCCCGTCCCGCAGGAGCCGAAGCCCGACGATACCTACGCACCGACGGAGGGCTCTTCC
AGCCAGCAGCCCCAGGCCCCTACCGAGGCGCAGCCCCAGTGCCCCGGCGGAGCCGCCTGCGGAGGAACCGACGGA
ACTTACGGCCAGCCGCAGTGCACTGACGGCTCCTGCGACAAGCCCGAGATCCCGTCTGACAGCCGGAAGGCTCCG
GAGCCGGCCGGGGAGGACGAGGAGGATGATGTCAACTACTGCTAG
Gene >Ophcf2|03553
ATGTACAGACTCACCTTTGCAGCCGGTGCCCTCGTGGCCATGCACGGCGTCCTCGCCCAGCAATCACCCGTAACG
GACCAATACCCAGCCGAACACACGGAAGAATTCAAGGGTTACGAGGGCCAATACGTCGACGCCTGCTCTCCCGTC
GGCACCATCCGCTACAACTCGACTTTCCCCCCCTGCCTGAGCTCCAGCAGGATCGAGTCCAGCTGCGCGCTGCCC
TGGAAGGAGGGCGTTTCGGATGAGCAGCGTCAGGGAGACTGGCAGGCGGAGAGGAAGTGTCTCTGCGAGGGCAGC
TTCTTTCGCGATGCGGGCGATGGATGCCTCGAGTGCAAGAAGGCGTACCACATTGACAGCGAGGAAAACGTCGAG
GTTTGGAAGACAGTCTGGAAGAAGATTGGTGACGGCTACTGCGAGGAGAAGACTCTGGCGGGTAACTTCTCGACC
TACTGGTCCGGAGCCCTCGCCGAGATCCAGGGCTCTTTCAAGTATGACAAAGACCTCGGCGCCAAGCCCGCTCCC
GGAAGCATCCCCGTCGAAGCCTACTACACCAACGACAAGCAAGGACCGGGACCCCTCCCCGGCTCGGCCCCGGCC
ACACCCGGCAACAGCTCCGTACCGTCCAACTCTACGGGAGAGGCCGGCGTCGCCCAGCTGACTCCCGACTGCCGA
ACCATGACGGGCGCCATCGACACCCTCCCCGCCAGCAACAGCGCCAAGTTCTCCAACTCCAGCACCGGCGCCATC
CTCGTGTCCGTCACCGTCAACTACAACCGCATCTGCATCATCAACGGTCCCCAGCGTGATATCCAGGCCGTTCCC
CAGTCTGAGCCCGAGGTTAAGCCCATCTCCGAGAAGGTGATTTCCAAGAAGGAGGCTGCCAAGGAGGCCGACTTC
GACATGACTGGCTGCCCTTGCGCTCAGAAGGCTGTCCCCGAGGGTAAGGAGGTTGTCAAGTCGGAGTCTTCGCTC
AACGCCTGGGCCAAGGTCTCTGTCATCTGCGGCTTCGACAAGGAGAGTCGAAAGGGTCCCGAGGGATGTGAGGGT
CCCGATTGCGGCGGTGCCAGCAAGGGTGACGAGGCGCCCTCGCCTGTTCCTGGCGATGTCTACGGCGCCGACTCC
GTCATGGGAACCTTTGGCGAATCCGAGGCCTCCAAGGGCTCTGACTCGGCCGAGAAGCCTTCCACCAAGAACACG
GTCTACGTCGTAAAGGTCAACAAGGAATCCTCCGGCAGTGAGACCGTGGGCACTTATGGTCAGCACAAGTGCACC
ACCTGCGGAAAGTCCAAGGCCCCCGAAGGACCCTTCACCGGCGAGACGGAGAACACCTACGGTCAGGACCAGCCC
GAGACCCCGGATGAGTCCCAGCCTGATCAGACCTACGGACAGCAAGAGGGCCCTTCAAACGAGCAGCCCCCGGCC
ACGTCCCCGGAACAGCCCAAGTGCGAAGCCTGCGAGAACAACAAGGGCCCGTACGGCTCCGAGCCCGAGACCCCC
TCCACCGAGCCCCAGGTCCCCGTCCCGCAGGAGCCGAAGCCCGACGATACCTACGCACCGACGGAGGGCTCTTCC
AGCCAGCAGCCCCAGGCCCCTACCGAGGCGCAGCCCCAGTGCCCCGGCGGAGCCGCCTGCGGAGGAACCGACGGA
ACTTACGGCCAGCCGCAGTGCACTGACGGCTCCTGCGACAAGCCCGAGATCCCGTCTGACAGCCGGAAGGCTCCG
GAGCCGGCCGGGGAGGACGAGGAGGATGATGTCAACTACTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail