Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03546
Gene name
Locationscaffold_03:3010285..3010721
Strand+
Gene length (bp)436
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1644 0.0536 0.9049 0.107 0.0789 0.0261 0.3187 0.2248 0.1779 0.0015

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999656

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5575
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1795
Ophiocordyceps camponoti-floridani Ophcf2|03546 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1865
Ophiocordyceps kimflemingae Ophio5|748
Ophiocordyceps subramaniannii Hirsu2|7311

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03546
MFPLGFILFALFSSAAADFGFFEQMFGGGGGGGGPSHDHSHTQQRMNPSDASLYHSAYGGSSCDKYLCPDTLACV
HFPHHCPCAWDANDDKFELADGKRICISKGGFKPGEAARKVELARKGLL*
Coding >Ophcf2|03546
ATGTTTCCTCTCGGCTTCATCCTGTTCGCTCTCTTCTCCTCCGCCGCCGCAGACTTCGGCTTCTTTGAGCAAATG
TTCGGCGGCGGAGGCGGTGGCGGCGGGCCAAGTCACGACCATTCACACACACAGCAACGCATGAACCCCAGCGAC
GCATCGCTCTACCATTCCGCCTACGGCGGCTCCTCGTGTGACAAGTATCTCTGCCCCGATACCCTCGCCTGCGTC
CACTTCCCGCATCACTGCCCATGTGCTTGGGATGCCAACGACGACAAGTTCGAGCTCGCTGATGGGAAGCGCATT
TGCATCTCAAAGGGCGGCTTCAAGCCGGGCGAGGCGGCGCGCAAGGTCGAGCTCGCGCGCAAGGGGCTCCTATAA
Transcript >Ophcf2|03546
ATGTTTCCTCTCGGCTTCATCCTGTTCGCTCTCTTCTCCTCCGCCGCCGCAGACTTCGGCTTCTTTGAGCAAATG
TTCGGCGGCGGAGGCGGTGGCGGCGGGCCAAGTCACGACCATTCACACACACAGCAACGCATGAACCCCAGCGAC
GCATCGCTCTACCATTCCGCCTACGGCGGCTCCTCGTGTGACAAGTATCTCTGCCCCGATACCCTCGCCTGCGTC
CACTTCCCGCATCACTGCCCATGTGCTTGGGATGCCAACGACGACAAGTTCGAGCTCGCTGATGGGAAGCGCATT
TGCATCTCAAAGGGCGGCTTCAAGCCGGGCGAGGCGGCGCGCAAGGTCGAGCTCGCGCGCAAGGGGCTCCTATAA
Gene >Ophcf2|03546
ATGTTTCCTCTCGGCTTCATCCTGTTCGCTCTCTTCTCCTCCGCCGCCGCAGACTTCGGCTTCTTTGAGCAAATG
TTCGGCGGCGGAGGCGGTGGCGGCGGGCCAAGTCACGACCATTCACACACACAGCAACGCATGAACCCCAGCGAC
GCATCGCTCTACCATTCCGCCTACGGCGGCTGTCTGTTCCCCTTGCAGCTTGCTCTTGTATTTCACTTGCTGACC
GTGTTCGTCAAATATAGCCTCGTGTGACAAGTATCTCTGCCCCGATACCCTCGCCTGCGTCCACTTCCCGCATCA
CTGCCCATGTGCTTGGGATGCCAACGACGACAAGTTCGAGCTCGCTGATGGGAAGCGCATTTGCATCTCAAAGGG
CGGCTTCAAGCCGGGCGAGGCGGCGCGCAAGGTCGAGCTCGCGCGCAAGGGGCTCCTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail